DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Klp3A

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001284830.1 Gene:Klp3A FlyBaseID:FBgn0011606 Length:1212 Species:Drosophila melanogaster

Alignment Length:633 Identity:170/634 (27%)
Similarity:256/634 (40%) Gaps:192/634 (30%)


  Fly    68 ATEGASCATSAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKV-------DSTSNN 125
            ::|..||..             |.||:||        :|..|   |...|::       .:....
  Fly     2 SSEDPSCVA-------------VALRVRP--------LVQSE---LDRGCRIAVERSADGAPQVT 42

  Fly   126 VNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTL-------L 180
            |||.|. :.:..:||....|:|:::|||..|:   :....|||:.||.:|||||||:       |
  Fly    43 VNRNES-YTYNYVFDIDDSQKDLFETCVQAKVKKLLNGYNVTILAYGQTGSGKTYTMGTAFNGVL 106

  Fly   181 GDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAH 245
            .|.|  |:||||:.:|||                          ::.|:|...:....|      
  Fly   107 DDHV--GVIPRAVHDIFT--------------------------AIAEMQSEFRFAVTC------ 137

  Fly   246 HQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK 310
                                        ||||:|.|..|||.:     .|..:....:::.|.|:
  Fly   138 ----------------------------SFVELYQEQFYDLFS-----SKTRDKATVDIREVKNR 169

  Fly   311 GHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG---ITT 372
              :.:.|||.:.|||:::....|..|......|:|::|..|||||.:||:.::.....|   :||
  Fly   170 --IIMPGLTELVVTSAQQVTDHLIRGSAGRAVAATAMNETSSRSHAIFTLTLVATKLDGKQSVTT 232

  Fly   373 QSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLT 437
             |.:...|||||||.:.|..||.|.||..|||..|:.||..::|..:.|.   |..||||.||||
  Fly   233 -SRFNLVDLAGSERCSKTLASGDRFKEGVNINKGLLALGNVINALGSGQA---AGYIPYRQSKLT 293

  Fly   438 MLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIA-----KNIIFKEP----------VIK 487
            .|||.:|.|.....||..|:|.|....|.|:.|.:|..|     |.::..:|          ||:
  Fly   294 RLLQDSLGGNSITLMIACVSPADYNVAETLSTLRYADRALQIKNKPVVNLDPHAAEVNMLKDVIQ 358

  Fly   488 QHRVSYC--GFMEFSKMST----------CEGG---------------DYTKELEDENVRLQLEI 525
            :.||...  |.|..|.:|.          ||..               :..:.|:|.|.:||.|:
  Fly   359 KLRVELLSGGKMSSSLISAVGAAGLGAIPCEESLAGSMANAAEIQRLKEQVRTLQDRNRKLQQEL 423

  Fly   526 EQLKYD--------HVLQMQLLEEKLRRELTATYQEIIQNNKKQY-------EDECEKKLLIAQR 575
            .|...|        |:.:.  ..:|||..::....::.|..:.|:       ::|.....|:..|
  Fly   424 HQSLLDLTEKEMRAHIAEQ--AHDKLRSHVSELKNKLDQREQAQFGNENTNGDNEMRDFSLLVNR 486

  Fly   576 ------------ESEFMLSSQR---RRYEEQIEDLKDEIEELKNPASD 608
                        ||:...|.||   |.:.|..|...||:.|:.:..|:
  Fly   487 VHVELQRTQEELESQGHESRQRLSSRSHTEGGESGGDEVHEMLHSHSE 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 126/413 (31%)
Kinesin 93..479 CDD:278646 125/411 (30%)
GBP_C <512..603 CDD:303769 28/121 (23%)
coiled coil 576..586 CDD:293879 5/13 (38%)
coiled coil 592..603 CDD:293879 4/11 (36%)
Klp3ANP_001284830.1 KISc_KIF4 7..336 CDD:276823 128/427 (30%)
Kinesin 14..335 CDD:278646 124/406 (31%)
Smc <396..>994 CDD:224117 29/142 (20%)
FlaC 522..633 CDD:225888 4/14 (29%)
TCR 1075..1110 CDD:281618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122352696
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.