DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif20b

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_006231343.1 Gene:Kif20b RGDID:1308497 Length:1781 Species:Rattus norvegicus

Alignment Length:752 Identity:198/753 (26%)
Similarity:314/753 (42%) Gaps:182/753 (24%)


  Fly     9 VPRREVRSFLMARDPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSSEATEGAS 73
            |||   .|::.:.||.      .||::..  ||.::......||                   ..
  Rat    10 VPR---PSYVFSADPI------ARPSEIN--FDGVKLDLSHEFS-------------------LV 44

  Fly    74 CATSAADSSNVETGPQVFLRLRPVKDASKAY------IVSEEANVLI---TSCKVDSTSNNVNRM 129
            .|...|:|...:...||.||:||...:.|.:      .|.:...||:   .|.....:..:..:|
  Rat    45 AANPGANSLESKNYLQVCLRIRPFTQSEKGHEAEGCVQVLDSQTVLLKDPQSILGHLSEKSSGQM 109

  Fly   130 EKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPR 191
            .:.|.|:.:|.....|::.:..|:...:   ::.....|.|||.:.||||||..|.:...||:||
  Rat   110 AQKFSFSRVFGPETSQKEFFQGCIMQPVKDLLKGHSRLIFTYGLTNSGKTYTFQGTEENIGILPR 174

  Fly   192 ALENIFTIYQDTVFRSPKLKLIN-GSIVFLQDDASLKELQIRKKLLDLCPDISAHHQ-------R 248
            .|..:|...|:.::.....|... ...:.|..|...:|...:..||....:::.|:.       |
  Rat   175 TLNVLFDSLQERLYTKMSFKPHRCREYLQLSSDQEKEESANKNTLLRQIKEVTIHNDSYDILCGR 239

  Fly   249 LKQVIDGDHMFETKASTDVSVL--------VWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLK 305
            |...:......||..:.:.|.|        |||||.|||||.:|||..  |...||.:  ||.|:
  Rat   240 LTNSLTIPEFEETMNNCEQSSLNVDNIKYSVWVSFFEIYNESIYDLFV--PVSSKLQK--RKMLR 300

  Fly   306 IVGN-KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG 369
            :..: ||:.|||.|..:.|:.|:||.|||:||.:..:.|.|.:|..|||||.:||:.||:...|.
  Rat   301 LSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQIEDSE 365

  Fly   370 I---TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPY 431
            |   |..|....||||||||...|.:.|.||:||.||||||:.||:|:.......|.|....:|:
  Rat   366 IPRVTRVSELSLCDLAGSERSMKTQSEGERLREAGNINTSLLTLGKCISVLKNSDKSKIQQHVPF 430

  Fly   432 RDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPV----------- 485
            |:||||...|:...||.|:.||:.::.....|:|.||||.|:::|:.:...:.:           
  Rat   431 RESKLTHYFQSFFTGKGKICMIINISQCCSAYDETLNVLKFSTVAQKVYVPDTLSSSQEKSFGST 495

  Fly   486 ------------------IKQHRVSYCGFMEFSKMSTCEGGDYTKELED----ENVRLQLE---- 524
                              :|:..||:    |.|.....|..|..::||:    :|:..:|.    
  Rat   496 KSLQDVSLGSNLDNKILNVKRKTVSW----ENSLEDVVENEDLVEDLEENEETQNMETELTDEDS 556

  Fly   525 ----------------------IEQLK---YDHVLQMQLLEEKLRRELT-----------ATYQE 553
                                  ||.||   .:...:...||.|:|.|:|           |.::|
  Rat   557 DKPLEEGGVCAGHGKNKKLLDLIENLKKRLINEKKEKLTLEFKIREEVTQEFTQYWSQREADFKE 621

  Fly   554 IIQNNKKQYEDECEKKLLI----------AQRESEFMLSSQRRRYEEQ-----IEDLKDEIEELK 603
            .:.:.::..|:..|::|.|          :|.|......:.....||.     :||:.|.:|:  
  Rat   622 TLLHEREILEENAERRLAIFKDLVGKPGESQDEPASRFCTMELETEESHNYVGVEDIFDSLED-- 684

  Fly   604 NPASDTDISD----------------DPNESKSPIEI 624
                  |::|                ||.|:.:.:::
  Rat   685 ------DVTDIKKQAELAHLYITSLVDPQEAIACLQL 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 143/420 (34%)
Kinesin 93..479 CDD:278646 140/418 (33%)
GBP_C <512..603 CDD:303769 28/150 (19%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 4/11 (36%)
Kif20bXP_006231343.1 KISc_KIF23_like 58..476 CDD:276819 143/422 (34%)
Kinesin 64..478 CDD:278646 140/418 (33%)
COG1340 1048..1337 CDD:224259
Rootletin 1097..>1248 CDD:291694
DUF4349 1180..1332 CDD:305044
Ax_dynein_light <1227..1302 CDD:287215
Tropomyosin 1251..1479 CDD:278679
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.