DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif23

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_021323261.1 Gene:kif23 ZFINID:ZDB-GENE-991019-4 Length:982 Species:Danio rerio

Alignment Length:711 Identity:181/712 (25%)
Similarity:297/712 (42%) Gaps:182/712 (26%)


  Fly    81 SSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNR--MEKHFGFTSIFDSTV 143
            |:|.:....|:.|:||:....:...:...:|..|.....|....|.|.  .|..:.|..:|....
Zfish    19 SNNQKDPVGVYCRVRPLGAEDEECCIEVISNTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKT 83

  Fly   144 GQRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTI---Y 200
            .||::::....|  :.::.:     .:.|||.:|||||:|:.|...:.|::||:|:.||..   |
Zfish    84 TQRELFEDVAKP--LAQDLIHGKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPY 146

  Fly   201 QDT--VFRSPKLKLINGSIVFLQDDASL-KELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETK 262
            |..  ||: |..|  ||..|..|.||.| ::.:..:..:...|:..........:|..:...:.:
Zfish   147 QAKRYVFK-PDDK--NGMEVQNQVDALLDRQKRDSQTSVPKTPNTRRVDPEFADMISPEEACKAE 208

  Fly   263 -ASTDVSVLVWVSFVEIYNELVYDLL------AIPPKQDKLGEVPRKNL--------KIV-GNKG 311
             ...|.|..|:||::||||..:||||      .|.||.:..| .|.:|:        ||: .::.
Zfish   209 GVDEDSSYSVFVSYIEIYNNYIYDLLEETPFDPIKPKWNGAG-TPVRNITEFIPPQSKILREDQN 272

  Fly   312 H-VFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV-----------DILK 364
            | :::.|.|.|.|.|:|||..:...||::...|:|.:|..|||||.||.|           |.:.
Zfish   273 HNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIVKLAQAPLDADGDNVL 337

  Fly   365 YNRSGITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADII 429
            .:::.:.. |.....|||||||.:.|...|.||:||.|||.|||.|..|::.....|......::
Zfish   338 QDKNQVNV-SQLCLVDLAGSERTSRTRAEGNRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMV 401

  Fly   430 PYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIA------------------ 476
            ||||||:|.|.:....|:.|:.|:|.|.|....|||.|.|:.||.:.                  
Zfish   402 PYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETLLVMRFAEMTQEVEVARPVDRPICGFAA 466

  Fly   477 ----KNIIFKE-----------------PVI---------------------------------K 487
                :|..|||                 |.:                                 |
Zfish   467 GRRQRNQAFKEELTRRLEERGGPVDGDCPTVLNQLLQAFPPLPPCEISGPNDDVTLPRLIEALEK 531

  Fly   488 QHRVSYCGFMEFSKMSTC--------EGGDYTKE-------------------LEDENVRLQLEI 525
            :|::......|::|.:|.        :|...:||                   .::|..||:.:.
Zfish   532 RHKIRQMMIEEYNKTATMLKSVLQEQDGNILSKENVIQEQRGKLGEKDKMLQNQKNEIDRLEKKS 596

  Fly   526 EQLKYD-HVLQ----------------MQLLEEKLRRELT------ATYQEIIQNNKKQYEDECE 567
            :.|:|. .:||                ::..|::|:||::      |..|.::.:.|.::|.|||
Zfish   597 KMLEYKIDILQKTTNIYEEDKRSLQNELESREQRLQREMSEKRRIEARMQGMVSDTKLKWEKECE 661

  Fly   568 KKLLIAQRESEFMLSSQRRRYEEQIEDLKDEIEELK-------NPASDTDISDDPNESKSP 621
            :::...|.|.:..|..:    :|:::.||..:.|.|       .|:.:.| ...|..|.||
Zfish   662 RRVNAKQLEMQNKLWVK----DEKLKQLKAIVTEGKTENRQPQRPSREKD-KVPPKRSASP 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 134/451 (30%)
Kinesin 93..479 CDD:278646 134/449 (30%)
GBP_C <512..603 CDD:303769 27/133 (20%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 3/11 (27%)
kif23XP_021323261.1 KISc_KIF23_like 24..449 CDD:276819 134/432 (31%)
SMC_N <526..699 CDD:330553 34/177 (19%)
MKLP1_Arf_bdg 825..928 CDD:318691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.