DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and klp8

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_594675.1 Gene:klp8 PomBaseID:SPAC144.14 Length:511 Species:Schizosaccharomyces pombe

Alignment Length:625 Identity:153/626 (24%)
Similarity:236/626 (38%) Gaps:209/626 (33%)


  Fly    81 SSNVETGPQVFLRLRP--VKDASKA-----YIVSEEANVLIT----SCKVDSTSNNVNRMEKHFG 134
            ::||    :|.:|:||  :::.||:     .:.|....|.||    ..|.....|.||. .:.|.
pombe     3 TANV----RVIVRVRPKSLRELSKSAEDLLSVDSHNKTVTITPPKHGLKHSRHKNRVNG-PRTFA 62

  Fly   135 FTSIFDSTV-------GQRDIYDTCVGP----KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGI 188
            |...|..:.       ||.|:|:: .||    .|:|......:|||..|:||||:::|...:.||
pombe    63 FDECFAPSAPESKNLSGQEDVYES-TGPLLVKSILEGFNSCFITYGQKGTGKTYSVVGLRGQPGI 126

  Fly   189 IPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVI 253
            ||...|:||.       ...|||                                          
pombe   127 IPHISESIFE-------EIDKLK------------------------------------------ 142

  Fly   254 DGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGH-----V 313
                    |.|.:.::.|.:|..||..|..||||             :.|:    |..|     |
pombe   143 --------KKSPNTTITVSISLAEIIEETPYDLL-------------QPNV----NSSHTPGETV 182

  Fly   314 FIK----------GLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSS------RSHCVFTVDI 362
            |::          ||:...|.|::|....|||       |:.::....|      :.|.||::.:
pombe   183 FVQKDSLTGYHLHGLSEFEVGSAQEIDAFLRL-------AAKNIRTELSDISGVRKGHSVFSLVV 240

  Fly   363 LK-----YNRSGITTQSSYKFCDLA----GSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAAS 418
            .:     ..|..:...|..:..|||    ||:|  |...|..   |:.:.|.||.||.|.:.|.:
pombe   241 QQRIIDPKTRHSLKKASRLQIIDLASFSKGSQR--NESISSF---ESSSNNKSLSVLNRVIAALT 300

  Fly   419 TVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAK------ 477
            :   |||..:|||:||.||.|||.||.|..:..|:..|:|.|  :::..:.|.::..|:      
pombe   301 S---KKNDVLIPYKDSVLTTLLQDALGGNCRTIMLTCVSPCD--FDDTFSALRYSEAARRIKNIS 360

  Fly   478 NIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEK 542
            ||..||        :|         ||...|    ||:|....|:.:.|||:.......:||  |
pombe   361 NINCKE--------AY---------STNNEG----ELDDILTTLESDREQLRRHEEHSQKLL--K 402

  Fly   543 LRRELTATYQEII-----QN---------------NKKQYE-DECEKKLLIAQRESEFMLSSQRR 586
            ...|:...|:|.|     ||               |..::. |:...||      .||  .|...
pombe   403 FIEEIRNDYEERIHALESQNSALKAHLRLAVDAYLNPLEFNFDDKNVKL------KEF--GSPNI 459

  Fly   587 RYEEQIEDLKDEIEELKNPAS--DTDISDDPNESKSPIEI 624
            .|::::...:.|:..|.....  .:.:.|.|....|.|::
pombe   460 AYKQELNSFQGELSSLFKDLKLVKSQLHDYPKPEVSDIDM 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 113/440 (26%)
Kinesin 93..479 CDD:278646 113/444 (25%)
GBP_C <512..603 CDD:303769 26/112 (23%)
coiled coil 576..586 CDD:293879 3/10 (30%)
coiled coil 592..603 CDD:293879 2/11 (18%)
klp8NP_594675.1 KISc 5..354 CDD:276812 115/446 (26%)
Kinesin 11..356 CDD:278646 112/438 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.