DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and klp9

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001342762.1 Gene:klp9 PomBaseID:SPBC15D4.01c Length:633 Species:Schizosaccharomyces pombe

Alignment Length:604 Identity:169/605 (28%)
Similarity:283/605 (47%) Gaps:110/605 (18%)


  Fly    89 QVFLRLR---PVKDASKAY---IVSEEANVLITSCKVDSTSNNVNR---MEKHFGFTSIFDSTVG 144
            |:|||::   |..|||..|   .|..:..:|:.|.: ||.:..|::   :|| ..||.:|..:..
pombe     3 QIFLRVKKAQPSSDASNKYGFLTVLNDYEILLESPE-DSHAYRVSKSKTLEK-ASFTKVFPPSCT 65

  Fly   145 QRDIYDTCVGPKIMEE----ECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQ---- 201
            |.|::.|...|.|.:.    ....:.|.|.||:||||||.|...|.|:...||:.:|...:    
pombe    66 QLDVFSTICAPLIADSLVNMNDTLLFTLGVSGAGKTYTLFGPSDRPGVAFLALDALFYAIKGREA 130

  Fly   202 --DTV--FRS--PKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFE 260
              .||  .||  .|.|::..| .||:.:|.| ::::        |:...:.....::.:.::.: 
pombe   131 SPQTVEFLRSQLEKCKIVEAS-KFLRGEAPL-DIKV--------PNTEYYASHFPKIEEKNYQY- 184

  Fly   261 TKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTS 325
                     .:::||.||||:.::|||   .|....|.....:||.........|.|:..|||::
pombe   185 ---------AIYLSFAEIYNDRIFDLL---EKASFFGHRHALSLKKSSTSDKKSIAGIQKVFVSN 237

  Fly   326 SEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFC-----DLAGSE 385
            :.||.:|::...|.....||..|:.|||||.:.::::.|.    .|..:.::.|     ||||||
pombe   238 TTEAYKLIQKVLQLRKSTSTKSNSVSSRSHLIMSIELFKV----CTKSNKFESCQIDLVDLAGSE 298

  Fly   386 RVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLL--QAALLGKE 448
            |..:..||||.|:|..:||.||:.||:||:|.....:.|. .|||:|.||||.||  ...|.|..
pombe   299 RTRSAETSGLLLREGASINRSLLTLGQCLEALRRKHEGKQ-HIIPFRQSKLTELLFHSGHLSGLA 362

  Fly   449 KLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYC---GFMEFSK--MSTCEGG 508
            .:.|:|.:.|... ::||..|:.:::.|:.|:  .|.:.::..|..   ..::.||  .||....
pombe   363 GINMLVNIDPFGS-FDENAQVMRYSANAREIL--PPPLNENSGSQSPSHSLLQKSKNTSSTKALT 424

  Fly   509 DYTKELEDENVRLQL-------EIEQLKYDHVLQM-QLLEEKL----RRELTATYQEIIQN---- 557
            .:.::|:.||.:|::       |:..|:|:...|| :.:||::    |..||...:|..|.    
pombe   425 SHLEQLQQENQQLRMLLADADSEMMNLEYEIRQQMTREMEERVSEVERTFLTKLLEESAQGIEYT 489

  Fly   558 ----------NKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLKDEIEELKNPASDTDIS 612
                      .||..::..||...|||             .|:.||:|.:|:..|:..:.....:
pombe   490 DQKLEKMGGWMKKLQDENSEKTETIAQ-------------LEQIIEELHEELRSLEEESIKESSA 541

  Fly   613 DDPNES---KSPIEILDDD 628
            ...||:   :|..::|.:|
pombe   542 TQQNENQHKRSSRKLLYED 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 128/418 (31%)
Kinesin 93..479 CDD:278646 125/416 (30%)
GBP_C <512..603 CDD:303769 29/117 (25%)
coiled coil 576..586 CDD:293879 0/10 (0%)
coiled coil 592..603 CDD:293879 5/11 (45%)
klp9NP_001342762.1 KIP1 40..633 CDD:227392 156/567 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1229
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T631658
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24115
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 1 0.960
77.060

Return to query results.
Submit another query.