DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and Kif20b

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_898867.1 Gene:Kif20b MGIID:2444576 Length:1774 Species:Mus musculus

Alignment Length:725 Identity:202/726 (28%)
Similarity:310/726 (43%) Gaps:150/726 (21%)


  Fly     9 VPRREVRSFLMARDPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSSEATEGAS 73
            |||   .|::.:.||..    ||....    ||.::          .|...|:...:|       
Mouse    10 VPR---PSYVFSADPIA----RPLEIN----FDGVK----------LDLSHEFSLVAS------- 46

  Fly    74 CATSAADSSNVETGPQVFLRLRPVKDASKAY------IVSEEANVLI---TSCKVDSTSNNVNRM 129
              ..||:|...:...||.||:||...:.|.:      .|.:..:||:   .|.....:..:..::
Mouse    47 --NPAANSLGSKNYLQVCLRIRPFTQSEKEHEAEGCVQVLDSQSVLLKDPQSILGHLSEKSSGQV 109

  Fly   130 EKHFGFTSIFDSTVGQRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPR 191
            .:.|.|:.:|.....|::.:..|:...:   :|.....|.|||.:.||||||..|.:...||:||
Mouse   110 AQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPR 174

  Fly   192 ALENIFTIYQDTVFRSPKLKLIN-GSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDG 255
            .|..:|...|:.::.....|... ...:.|..|...:|...:..||....:::.|:... .|:.|
Mouse   175 TLNVLFDSLQERLYTKMSFKPHRCREYLKLSSDQEKEESANKNTLLRQIKEVTIHNDSY-DVLCG 238

  Fly   256 DHM--------FETKA-STDVSVL--------VWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKN 303
             |:        ||... |.|.|.|        |||||.|||||.:|||..  |...|..:  ||.
Mouse   239 -HLTNSLTIPEFEESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFV--PVSSKFQK--RKM 298

  Fly   304 LKIVGN-KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNR 367
            |::..: ||:.|||.|..|.|:.|:||.|||:||.:..:.|.|.:|..|||||.:||:.||:...
Mouse   299 LRLSQDIKGYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQIED 363

  Fly   368 SGI---TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADII 429
            |.|   |..|....||||||||...|...|.||:||.||||||:.||:|::.....:|.| ...:
Mouse   364 SEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSEKSK-VQHV 427

  Fly   430 PYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYC 494
            |:|:||||...|:...||.|:.||:.::.....|:|.||||.|::.|:.:...:.:......|:.
Mouse   428 PFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYVPDTLSSSQEKSFA 492

  Fly   495 GFMEFSKMSTCEGGD------------YTKELED--ENVRLQLEIEQLKYDHVLQMQLLEE---- 541
            .......:|.....|            :...|||  ||..|..::|:.:....::.:|.:|    
Mouse   493 SNKSLQDVSLDSNLDNKILNVKRKTVSWENSLEDVLENEDLVEDLEENEETQNMETELTDEDSDK 557

  Fly   542 -----------KLRRELTATYQEIIQNNKKQYEDECEKKLLI----------------AQRESEF 579
                       |..:||.    ::|:...|:..:|.::||.:                :|||::|
Mouse   558 SLEECRVSTCHKKNKELL----DLIEKLNKRLINENKEKLTLELKIREEVTQEFTQYWSQREADF 618

  Fly   580 --MLSSQRRRYEEQIE------------------------DLKDEIEELKNPASDTDI----SDD 614
              .|..:|...||..|                        |::.|.||..|.....||    .||
Mouse   619 KETLLHEREILEENAERRLAIFKDLVGKCDSQDEPTNRICDIELETEEAHNYVGVEDIFHSLQDD 683

  Fly   615 PNESKSPIEI 624
            ..:.|...|:
Mouse   684 VTDIKKQAEL 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 146/422 (35%)
Kinesin 93..479 CDD:278646 143/420 (34%)
GBP_C <512..603 CDD:303769 30/150 (20%)
coiled coil 576..586 CDD:293879 4/12 (33%)
coiled coil 592..603 CDD:293879 5/35 (14%)
Kif20bNP_898867.1 KISc_KIF23_like 58..475 CDD:276819 146/424 (34%)
Kinesin 64..477 CDD:278646 143/420 (34%)
Necessary and sufficient for interaction with SHTN1. {ECO:0000269|PubMed:23864681} 1002..1059
COG1340 1041..1319 CDD:224259
DUF4349 1179..1331 CDD:305044
Ax_dynein_light <1228..1301 CDD:287215
Tropomyosin 1250..1478 CDD:278679
Interaction with PIN1. {ECO:0000250|UniProtKB:Q96Q89} 1514..1774
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.