DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and zen-4

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001023312.2 Gene:zen-4 WormBaseID:WBGene00006974 Length:787 Species:Caenorhabditis elegans

Alignment Length:582 Identity:169/583 (29%)
Similarity:271/583 (46%) Gaps:114/583 (20%)


  Fly    77 SAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDS 141
            |..::.::|    |..||.|...::.:.|..:|.::............|..::||.|.|..:|..
 Worm    21 SIEETDSIE----VVCRLCPYTGSTPSLIAIDEGSIQTVLPPAQFRRENAPQVEKVFRFGRVFSE 81

  Fly   142 TVGQRDIYD-TCVG--PKIMEEECVTIMTYGTSGSGKTYTLLG--DDVRAGIIPRALENIFTIYQ 201
            ..||..::: |.|.  ..:::.:...:.|||.:|||||||:.|  .:...|::||.|        
 Worm    82 NDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTL-------- 138

  Fly   202 DTVFRSPKLKLINGSI---VFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVID--------G 255
            |.:|.|     ||..:   :|.  .::|...:||..|       .||.:|.:...|        .
 Worm   139 DVIFNS-----INNRVEKCIFY--PSALNTFEIRATL-------DAHLKRHQMAADRLSTSREIT 189

  Fly   256 DHMFET-KAS---TDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIV-------GN 309
            |...|. |.|   .|:...|:|::|||||...||||          |..|...:::       ..
 Worm   190 DRYCEAIKLSGYNDDMVCSVFVTYVEIYNNYCYDLL----------EDARNGSRVLTKREIRHDR 244

  Fly   310 KGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQS 374
            :..:::.|...|.|:||||||.:..||::|...:||.:|.:|||||.|||:.::...|: ..|:|
 Worm   245 QQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRA-YETKS 308

  Fly   375 SY-----------KFC--DLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQK--KK 424
            .|           :.|  |||||||...|...|.||.||.:||.|||.|.:|::.....||  .:
 Worm   309 VYPTMDSSQIIVSQLCLVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQ 373

  Fly   425 NADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPV--IK 487
            |.:.:|||.||||.|.:..|.|..|:.|::.|.|....|:||::.|.||..::.|..|:.|  :.
 Worm   374 NLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKKQVERMP 438

  Fly   488 QHRVSYCGFMEFSKMSTCEGGDYTKELEDENVRLQLEI---------EQLKYDHVLQMQLLEEKL 543
            ..|:.:..|.:::  |..:|   :..:||:..|   ||         :....|.|..|.    |.
 Worm   439 SERIPHSFFTQWN--SELDG---SVRMEDDGSR---EIPCPPTFCLTDCNDKDTVDSMY----KY 491

  Fly   544 RRELTATYQEIIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYE-EQIED-LKDEIEELK 603
            .|:|::     :||:.   |:.....||...|  ::|:.:..:|.| .:::| |.|:.||:|
 Worm   492 ARKLSS-----LQNSS---EEGPSSTLLTMIR--QYMMEADYQRVEIARLKDSLNDKDEEIK 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 134/430 (31%)
Kinesin 93..479 CDD:278646 133/428 (31%)
GBP_C <512..603 CDD:303769 25/102 (25%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 5/12 (42%)
zen-4NP_001023312.2 Motor_domain 26..426 CDD:277568 135/437 (31%)
KISc 27..434 CDD:214526 137/444 (31%)
MKLP1_Arf_bdg 674..>748 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.