DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and klp-7

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001022677.1 Gene:klp-7 WormBaseID:WBGene00002219 Length:747 Species:Caenorhabditis elegans

Alignment Length:597 Identity:151/598 (25%)
Similarity:231/598 (39%) Gaps:151/598 (25%)


  Fly     9 VPRREVRSFLMARDPSIDRRFRPRPNKKMRLF--DNIQESEEE-SFSE-YSDTESEYKYQSSEAT 69
            ||...:.:....|.||...|. |.|....|.:  .::|.|... :|:| ..:..::..|:.....
 Worm   250 VPAPPIANMTSQRAPSPVARV-PSPKNVPRSYPQQDVQPSNGNFAFAEMIRNYRAQIDYRPLSMF 313

  Fly    70 EGASCATSAADSSNVETGPQVFLRLRPV--KDASKA-----YIVSEEANVL-ITSCKVDSTSNNV 126
            :|.:           |....|.:|.||:  |:.:||     .|.|.:..:| ....:||.|....
 Worm   314 DGVN-----------ENRISVCVRKRPLNKKELTKAEVDVITIPSRDITILHQPQTRVDLTKYLD 367

  Fly   127 NRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGI 188
            |   :.|.|...||.......:|.....|   .:.:....|...||.:|||||:|:.||  .:|.
 Worm   368 N---QKFRFDYSFDEYANNELVYRFTAAPLVKTVFDNGTATCFAYGQTGSGKTHTMGGD--FSGK 427

  Fly   189 IPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVI 253
            ...|...|:.:....|||                  .|::.|.|:|      |:|.|        
 Worm   428 KQNASMGIYALTARDVFR------------------MLEQPQYRRK------DLSVH-------- 460

  Fly   254 DGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK-GHVFIKG 317
                               .:|.|||....||||     .||      ..|:::.:| ..|.:.|
 Worm   461 -------------------CAFFEIYGTKTYDLL-----NDK------AELRVLEDKMQKVQVVG 495

  Fly   318 LTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKFCDLA 382
            |......:.::.|.|:..|....|..:||.||||||||.:|.:.:    |.|......:...|||
 Worm   496 LKEEQAHNEQDVLELINKGTLVRTAGTTSANANSSRSHAIFQIIL----RQGKKVWGKFSLIDLA 556

  Fly   383 GSERVNNTGTSGL-RLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLG 446
            |:||..:|..... ..||..||||||:.|..|:...:     :|:..:|:|.|||||:|:.:.:|
 Worm   557 GNERGQDTRECDRDTRKEGANINTSLLALKECIRGMA-----RNSSHVPFRQSKLTMVLRDSFIG 616

  Fly   447 -KEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI---------------IFKEPVIKQHRVSYCG 495
             |.:..||..::|.....:..||.|.:|...|.:               :|..|           
 Worm   617 EKSRTVMISMISPGISSSDHTLNTLRYADRVKEMGTDGSGEATPIRDEELFLPP----------- 670

  Fly   496 FMEFSKMSTCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKK 560
                       ..|.:.|..||.|..| |..::..|||..::.:.||:.||.|     |:.:|:.
 Worm   671 -----------SADKSDEEYDEMVEKQ-EHRRVAVDHVRNLKDMSEKIIRETT-----IVLSNEP 718

  Fly   561 Q--YEDECEKKL 570
            .  .:.||..||
 Worm   719 SAAQKAECLAKL 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 111/402 (28%)
Kinesin 93..479 CDD:278646 111/400 (28%)
GBP_C <512..603 CDD:303769 20/62 (32%)
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
klp-7NP_001022677.1 KISc_KIF2_like 320..648 CDD:276818 111/404 (27%)
Kinesin 326..649 CDD:278646 111/399 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.