DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and KIF20A

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_005724.1 Gene:KIF20A HGNCID:9787 Length:890 Species:Homo sapiens

Alignment Length:695 Identity:198/696 (28%)
Similarity:318/696 (46%) Gaps:160/696 (23%)


  Fly    63 YQSSEATEG--------ASC---ATSAADSSNVETGP-----QVFLRLRPV------KDASKAYI 105
            ::|:.|..|        :.|   :||..|...|.:..     :|:||:||:      :...:..:
Human    24 FESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCV 88

  Fly   106 VSEEANVLITSCKVD-----STSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGPKIMEEECV-- 163
            ..|....|:.....|     |....:.:....|.|:.||...|||...::..|  |.|.::.:  
Human    89 RIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTV--KEMVKDVLKG 151

  Fly   164 ---TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLK-LINGSIVFLQDDA 224
               .|.|||.:.||||:|:.|.....||:||:|..||...|..:..:|.|| |::..:::| |..
Human   152 QNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWL-DSK 215

  Fly   225 SLKELQIRKKLLDLC------PDISAHHQR-----------------------LKQVIDGDHMFE 260
            .:::.:::|  |.|.      .::|...:|                       :.|......:.|
Human   216 QIRQEEMKK--LSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDE 278

  Fly   261 TK---ASTDVSVL---------VWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK-GH 312
            |.   |..|.:.|         :|:||.||||||:||||..|.:|.|     |:.|::..:: |:
Human   279 TSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRK-----RQTLRLCEDQNGN 338

  Fly   313 VFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG--ITTQSS 375
            .::|.|..:.|..:|||.:||::|::..::|||.:|.||||||.:|::.||.....|  :...|.
Human   339 PYVKDLNWIHVQDAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISE 403

  Fly   376 YKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDA-ASTVQKKKNADIIPYRDSKLTML 439
            ...||||||||..:. .||.|||||.||||||..||||:.| ....|.:...:::|:||||||.:
Human   404 LSLCDLAGSERCKDQ-KSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRV 467

  Fly   440 LQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPV----------IKQHRVSYC 494
            .|....|:.:..|||.|.|....|:|.|:|..|::||..::...|:          ||:|.:...
Human   468 FQGFFTGRGRSCMIVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVS 532

  Fly   495 GFME-FSKMSTCEGGD---------YTKE-------------LEDENVRLQLE-----------I 525
            ..:| .:|..|....|         |.||             |::...:||||           :
Human   533 PSLEKGAKADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMV 597

  Fly   526 EQLKY------DHV-LQMQLLEEK-------LRRELTATYQEIIQNNKKQYEDECEKKLLIAQRE 576
            ||::.      :|: .|.:||||.       |:..||:.|||.||...::.| |.|..|..|:::
Human   598 EQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIE-ELEALLQEARQQ 661

  Fly   577 --------SEFMLSSQRR----RYEEQIEDLKDEIEELKNPASDT 609
                    ||..|...:|    ...:|::::|.::::.|...:.|
Human   662 SVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNST 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 145/450 (32%)
Kinesin 93..479 CDD:278646 143/448 (32%)
GBP_C <512..603 CDD:303769 34/141 (24%)
coiled coil 576..586 CDD:293879 3/18 (17%)
coiled coil 592..603 CDD:293879 1/11 (9%)
KIF20ANP_005724.1 KISc_KIF23_like 63..505 CDD:276819 145/453 (32%)
SMC_N <547..>795 CDD:330553 38/162 (23%)
Globular. {ECO:0000255} 763..890
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4904
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 1 1.000 FOG0004952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_136001
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R641
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.