DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and LOC100489788

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_004915250.1 Gene:LOC100489788 XenbaseID:XB-GENE-5953085 Length:787 Species:Xenopus tropicalis

Alignment Length:673 Identity:193/674 (29%)
Similarity:316/674 (47%) Gaps:135/674 (20%)


  Fly    56 DTESEYKYQSSEATEGASCAT--SAADSSNV-----ETGP-QVFLRLRPVKDASKAYIVSEEANV 112
            |..|.|..:.|...:..:|:|  .|.||.:|     .:.| :|:||:||.   |||.:.|.||..
 Frog     5 DESSVYPAELSSVLDPPACSTIIDALDSDSVLLSDPASHPLKVYLRVRPF---SKAELASNEAQG 66

  Fly   113 LIT-------SCKVDSTSNNVNRMEKHFG-------FTSIFDSTVGQRDIYDTCVGPKIMEEECV 163
            .:|       |.:....|:.:...|:..|       ||.||.....|.:.::..:      :|.|
 Frog    67 CVTIENGELVSLRAPKDSSTMKNCERGIGQSVHKFTFTRIFGHETSQAEFFEGTM------KEVV 125

  Fly   164 T---------IMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLK-LINGSIV 218
            .         :.|||.:.:|||:|:.|.....||:||:|:.||:..:...:|...|| .::..|:
 Frog   126 NSFSDGQNGLVFTYGVTNAGKTFTIQGTPKDGGILPRSLDVIFSHMKGRQYRRMNLKPYLSNDIM 190

  Fly   219 FLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKA------STDVSVL------- 270
            .|:.....:|..::..||.     |.....:|.|....::.::.:      |.|.||.       
 Frog   191 KLEAAQVKQEESMKASLLS-----SLKEDGMKSVPSSSNLKQSMSTSCESISNDGSVCGSLECED 250

  Fly   271 -------VWVSFVEIYNELVYDLL-AIPPKQDKLGEVPRKNLKIVGNK-GHVFIKGLTSVFVTSS 326
                   .||:|.|||||.||||| ..|..:::    .|..|||..:: |:.::|.|..:.:.|:
 Frog   251 GDAVQFSAWVAFFEIYNEYVYDLLDQFPSSKNQ----KRPALKICDDQSGNSYVKDLKWINIAST 311

  Fly   327 EEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG---ITTQSSYKFCDLAGSERVN 388
            |||.::|:.|.:..:.|||.:|..|||||.:|||.:||.....   :.|.|....||||||||.|
 Frog   312 EEACKILQFGNKNRSLASTRMNQQSSRSHSIFTVRLLKLTADDDPRVLTVSEMSLCDLAGSERCN 376

  Fly   389 NTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMI 453
            .|.|.|.|||||.|||.||::||:|:.|....|..|.|..:|:|:||||.|.|....||.|..||
 Frog   377 KTQTVGDRLKEAGNINNSLLILGKCIGALKQSQNPKKASYVPFRESKLTRLFQPFFCGKGKACMI 441

  Fly   454 VTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYT------- 511
            |.:......|:|.|:|:.|:::||.::   ..|:.....:.|    .:|...:|...|       
 Frog   442 VNINQCASTYDETLHVMKFSAVAKQVV---QSIQPRNFEFMG----PRMVGKDGKVITEIDPNIS 499

  Fly   512 -KEL----EDENVRLQLEIEQL--KYDHVLQMQL--------LEEKLRREL-TATYQEII----- 555
             :||    |||.:.:.:..|.|  |.:.|.:..|        ||.::|:|: .|.||:::     
 Frog   500 VEELLSDDEDEELDVTMNPEDLLKKIEEVREKLLAERQSKLVLELQIRKEMGEAMYQQMVDLDET 564

  Fly   556 -----QNNKKQYEDECEKKLLIAQR--------------ESEFMLSSQRRRYEEQIEDLKDEIEE 601
                 ::.|:.:|::.|.:|.:.::              |..::...:.:..:|::|:.:..|:|
 Frog   565 WSKRFEDLKETHEEQLESRLEMYKKAIKNHAYRQAMDELEENYVPLDEFQAEQEKVEEKEQRIQE 629

  Fly   602 ------LKNPASDTDISDDPNES 618
                  |:||:.:.:.|....|:
 Frog   630 LEIALGLRNPSGEEETSQGALEA 652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 145/437 (33%)
Kinesin 93..479 CDD:278646 144/435 (33%)
GBP_C <512..603 CDD:303769 27/136 (20%)
coiled coil 576..586 CDD:293879 1/10 (10%)
coiled coil 592..603 CDD:293879 4/17 (24%)
LOC100489788XP_004915250.1 KISc 44..468 CDD:214526 147/442 (33%)
KISc_KIF23_like 44..465 CDD:276819 146/439 (33%)
DUF2317 <491..614 CDD:302887 23/123 (19%)
MreC 661..>738 CDD:302802
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 1 1.000 FOG0004952
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.