DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif20b

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_012822228.1 Gene:kif20b XenbaseID:XB-GENE-1005036 Length:1864 Species:Xenopus tropicalis

Alignment Length:714 Identity:200/715 (28%)
Similarity:316/715 (44%) Gaps:162/715 (23%)


  Fly    28 RFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQSSEATEGASCATSAADSSNVETGPQVFL 92
            |..|:|      .|:::.:..|.|.....:.||..             .:..:|...:...||:|
 Frog    25 RDEPQP------IDDLRTNLAEKFLSLGGSVSETN-------------PNQKNSLGSQEHMQVYL 70

  Fly    93 RLRPV-------KDASKAYIVSEEANVLI------TSCKVDSTSNNVNRMEKHFGFTSIFDSTVG 144
            |:||.       .:|.....:.:.::||:      .||::....|  ..|.:.|.||.:|.....
 Frog    71 RVRPFTAVEIEQNEAQDCISIPDSSSVLVKPPHNSQSCRLSDKGN--GSMAQKFTFTHVFGPDTT 133

  Fly   145 QRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFR 206
            |...:|..:...:   |:.:...|.|||.:.:|||:|..|....|||:||:::.:|...|..|:.
 Frog   134 QAQFFDGTIKQHVIDFMKGQNRLIFTYGVTNAGKTFTFQGTKDDAGILPRSMDMLFNSIQGRVYT 198

  Fly   207 SPKLK------LINGSIVFLQDDASLKELQIRK-KLLDLCPDISAHHQRLKQVIDGDHMFETKAS 264
            ...:|      .|..:...::.:|:||...:|: |.:| | .|.:::.|..|  |.......:..
 Frog   199 KMDVKPYRCKDYIRLTKEQVKAEAALKNSVLRQMKEVD-C-SIRSNNSRTCQ--DTTDFSNDEGF 259

  Fly   265 TDVSVL------------------------VWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLK 305
            |:.|:|                        |||||.|||||.:||||. |...||  ...||.|:
 Frog   260 TNSSMLSDMDIHVRQSEEFKLPLDSLAKFSVWVSFCEIYNECIYDLLD-PISGDK--SYKRKTLR 321

  Fly   306 I-VGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG 369
            : :..||:.|:|.|..:.|:.:.||.::|.||::..:.|.|.:|::|||||.:|||.:||...|.
 Frog   322 LALDLKGYSFVKDLQWIEVSDATEACKILALGKKFQSIAYTKLNSSSSRSHSIFTVRLLKIEDSD 386

  Fly   370 I---TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPY 431
            |   ...|....||||||||...|...|.||||:.||||||::||:|::|..|.|..|....:|:
 Frog   387 IPRVLKVSELALCDLAGSERCTKTQNEGERLKESGNINTSLLILGKCINALKTSQHSKAHQHVPF 451

  Fly   432 RDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSY--- 493
            |:||||..||:...||.|:.|||.:......|:|.||||.|:::|:.::..|.  .|:..:|   
 Frog   452 RESKLTHYLQSFFSGKGKVCMIVNICQSASSYDETLNVLKFSAVAQKVLILES--SQNSEAYGQR 514

  Fly   494 -----CGFM---------------------------------EFSKMSTCEGGDYTKELEDENVR 520
                 ..|:                                 |.|:...|....|..|.||:.|:
 Frog   515 KSAREVSFIINNADSKVWNSRKRATVQWDSRLEDVPEDGNSEEDSEEEECLDCTYQDEEEDDGVQ 579

  Fly   521 L-QLEIEQLKYDHVLQM---------------QLLEEKLRRELTATYQEIIQNNKKQYEDECEKK 569
            . :|.|::..|..:|.:               .|:|.|:|.|:...:.|.....:|.:.:..|| 
 Frog   580 EDELVIKKDAYQKLLDLVEDLKTKLVNEKKDKLLMELKIREEVAKEFTEHFMQREKDFSEHLEK- 643

  Fly   570 LLIAQRESEFMLSSQRRRYEEQIE---DL-------KDEIEELKNPASDTDISDDPNESKSPIE 623
                  |.|.|    ..|.:|:||   ||       :||.||.:|   ..:.:|...::.:||:
 Frog   644 ------EKELM----EERCDERIEIFQDLVRKCSKSEDEGEEDEN---RDNTADQVEQTDTPID 694

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 149/439 (34%)
Kinesin 93..479 CDD:278646 146/437 (33%)
GBP_C <512..603 CDD:303769 30/117 (26%)
coiled coil 576..586 CDD:293879 3/10 (30%)
coiled coil 592..603 CDD:293879 8/21 (38%)
kif20bXP_012822228.1 Motor_domain 64..497 CDD:277568 149/442 (34%)
Kinesin 71..499 CDD:278646 146/437 (33%)
PRK01156 <699..1223 CDD:100796
COG1340 1048..1356 CDD:224259
TMPIT 1188..>1303 CDD:285135
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.