DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sub and kif20bb

Sequence 1:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_021335955.1 Gene:kif20bb ZFINID:ZDB-GENE-030131-9684 Length:1547 Species:Danio rerio

Alignment Length:683 Identity:186/684 (27%)
Similarity:317/684 (46%) Gaps:136/684 (20%)


  Fly    34 NKKMRLFDNI--QESEEESFSEYSDTESEYKYQSSEATEGASCATSAADSSNVETGP-QVFLRLR 95
            |.|....|:|  ::..::.|||:|..                    :.||.::|... ||:||:|
Zfish     7 NHKPDRVDSITVEDLRKDLFSEFSKL--------------------SRDSVSLEKEHLQVYLRVR 51

  Fly    96 PVKDASKAYIVSEEA-------NVLITSCKVDSTSNNVNR----MEKHFGFTSIFDSTVGQRDIY 149
            |.....:|...|::.       .|::.:.|...|:.:..|    :.:.|.|:.::.....|::|:
Zfish    52 PFTSTERAEGESQDCISIEPPDTVILKAPKASLTARHSERFGPQLAQRFQFSQVYGPETTQKEIF 116

  Fly   150 DTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPK 209
            |...  |.:.:|.:     .|.|||.:.:|||:|.||.:...||:||:|..||...:..::....
Zfish   117 DGTT--KSLVKEVLDGGNSLIFTYGVTNAGKTFTFLGPESDGGILPRSLNVIFNSIEGRIYLQNN 179

  Fly   210 LKLINGSIVFL------QDDASLKELQIRKKLLD----------LCPDISAHHQRLKQVIDGDHM 258
            :| .:..:.|.      ||:.:..:..:.::..|          .....|:........::||.:
Zfish   180 IK-PHRCVDFTRLTKEQQDEEATNKRNLLRRFKDNDSQKTLSSMSSSSCSSFDSSTSSDMNGDSV 243

  Fly   259 FETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGN-KGHVFIKGLTSVF 322
            :..:.| .|...|||||.|||||.::|||...|.    |...|..|::..: |.:.|:|.|..|.
Zfish   244 YLDEDS-HVKFSVWVSFCEIYNESIHDLLDFVPN----GSHRRNALRLAQDVKSNSFVKDLKWVQ 303

  Fly   323 VTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG---ITTQSSYKFCDLAGS 384
            |.|::|||:::::|::..:::||.:|..|||||.:|::.:|:....|   :.|.|....||||||
Zfish   304 VNSADEALKVVKIGRKNQSFSSTKLNNISSRSHSIFSIRMLRIEDVGVPRVQTISELSLCDLAGS 368

  Fly   385 ERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQ-KKKNADIIPYRDSKLTMLLQAALLGKE 448
            ||...|...|.|||||.||||||:.||:|::|....| :.|....||:|:||||..||....|:.
Zfish   369 ERCARTQNRGERLKEAGNINTSLLTLGKCINALRLNQTQSKFHQHIPFRESKLTHYLQGYFCGRG 433

  Fly   449 KLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEP------VIKQHR------VSYCGFMEFSK 501
            |..||:.:......|:|.||||.|:::|:.::...|      .:|:..      ::.....::::
Zfish   434 KACMIININQCASVYDETLNVLKFSAVAQKVVVLNPKPAPSIALKRSARDVSMIINNADKKDWTR 498

  Fly   502 MSTCEGGDYTKE--LEDEN------------------------------VRLQLEIEQLKYDHVL 534
            .|:..|.:.:.|  .||||                              ..||::||:|:...:.
Zfish   499 RSSIMGWEMSLEDVQEDENDEDMDEEEVESDDESIVDRTVLETVENQELCELQVKIEELQEKLIK 563

  Fly   535 QMQ---LLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLK 596
            :..   .||.::|.|:|..:.|:..|.:|.|.:.       .|||.|.:.....||         
Zfish   564 EESEKLTLEARIREEVTTEFMELFSNMEKDYSER-------LQREKEIVEERAERR--------- 612

  Fly   597 DEIEELKNPASDT--DISDDPNESK-SPIEILD 626
              :|.|||..:.|  :::.|.|.:| :.:|:||
Zfish   613 --LEILKNLVNRTIEEMTTDENAAKEAKMELLD 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 135/425 (32%)
Kinesin 93..479 CDD:278646 132/423 (31%)
GBP_C <512..603 CDD:303769 27/126 (21%)
coiled coil 576..586 CDD:293879 2/10 (20%)
coiled coil 592..603 CDD:293879 2/11 (18%)
kif20bbXP_021335955.1 Motor_domain 42..462 CDD:328930 135/428 (32%)
SMC_N <544..1161 CDD:330553 31/119 (26%)
TOP2c <1287..1532 CDD:330395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0247
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D314538at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597232
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.