| Sequence 1: | NP_650123.1 | Gene: | sad / 44858 | FlyBaseID: | FBgn0003312 | Length: | 520 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_564384.1 | Gene: | CYP97A3 / 840067 | AraportID: | AT1G31800 | Length: | 595 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 427 | Identity: | 96/427 - (22%) | 
|---|---|---|---|
| Similarity: | 172/427 - (40%) | Gaps: | 99/427 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    94 YGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQ-------QHACQRGLFF 151 
  Fly   152 MEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPL 216 
  Fly   217 LEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVF----EHSSRLMTFPPRLAQILR 277 
  Fly   278 LPIWRDFEAN----------VDEVLREGAAIIDHCIR-VQEDQRRPHDE-------ALYHRLQAA 324 
  Fly   325 --DVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE----------------R 371 
  Fly   372 ATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPER 436 
  Fly   437 VLPERWCI-----GETEQVHKSHGSLPFAIGQRSCIG 468 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| sad | NP_650123.1 | p450 | 63..497 | CDD:299894 | 96/427 (22%) | 
| CYP97A3 | NP_564384.1 | PLN02738 | 1..595 | CDD:215393 | 96/427 (22%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24291 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||