DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP97B3

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_193247.2 Gene:CYP97B3 / 827177 AraportID:AT4G15110 Length:580 Species:Arabidopsis thaliana

Alignment Length:422 Identity:92/423 (22%)
Similarity:162/423 (38%) Gaps:110/423 (26%)


  Fly   147 RGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKR--RTAEAAA----IPLAE 205
            :||...:...|...||.:........|..|......|:.:|:.:.::  |..|.::    |.|..
plant   158 KGLIPADLDTWKLRRRAITPAFHKLYLEAMVKVFSDCSEKMILKSEKLIREKETSSGEDTIELDL 222

  Fly   206 SGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSR------ 264
            ..|..|..|.::...::.:.        ||:.....|.|::       :...:||...|      
plant   223 EAEFSSLALDIIGLSVFNYD--------FGSVTKESPVIKA-------VYGTLFEAEHRSTFYFP 272

  Fly   265 LMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCI-----RVQEDQRRPHDEALYHR---- 320
            ...|||  |:.: :|..|.|::::        .||:.|:     ..:|.::....|.|..|    
plant   273 YWNFPP--ARWI-VPRQRKFQSDL--------KIINDCLDGLIQNAKETRQETDVEKLQERDYTN 326

  Fly   321 ------------LQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKERAT 373
                        ::..|:....::...:.::||..:|||....||:|.||:.|   :::.|.:|.
plant   327 LKDASLLRFLVDMRGVDIDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLSQNP---EKIRKAQAE 388

  Fly   374 NDSRLMHG---------------LIKESLRLYPVAP-FIGRYLPQDAQLGGHFIEKD-------T 415
            .|:.|..|               ::.|.|||:|..| .|.|.|..:...|||..||:       |
plant   389 IDAVLGQGPPTYESMKKLEYIRLIVVEVLRLFPQPPLLIRRTLKPETLPGGHKGEKEGHKVPKGT 453

  Fly   416 MVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVH-----------KSHGS------------L 457
            .:.:|:|...|.|..::.|....|||:.  .|::.:           :|.|:            |
plant   454 DIFISVYNLHRSPYFWDNPHDFEPERFL--RTKESNGIEGWAGFDPSRSPGALYPNEIIADFAFL 516

  Fly   458 PFAIGQRSCIGRRVALKQLHSLLGRCAAQFEM 489
            ||..|.|.|||.:.||.:....|.....:|::
plant   517 PFGGGPRKCIGDQFALMESTVALAMLFQKFDV 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 92/423 (22%)
CYP97B3NP_193247.2 p450 72..580 CDD:299894 92/423 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.