DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and LUT1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_190881.2 Gene:LUT1 / 824479 AraportID:AT3G53130 Length:539 Species:Arabidopsis thaliana

Alignment Length:524 Identity:113/525 (22%)
Similarity:196/525 (37%) Gaps:155/525 (30%)


  Fly    64 GLPVVGTLVDLIA--AGGATH--LHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHE 124
            |:|:....:|.:|  .|||..  |:|:::    :||||:| ...|.::.|.||...:.:.|.::.
plant    78 GIPIANAKLDDVADLLGGALFLPLYKWMN----EYGPIYR-LAAGPRNFVIVSDPAIAKHVLRNY 137

  Fly   125 GQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIE----SCTR 185
            .:|.:..:.:.     .:.....|....||..|...||.:...|   :..::.|.:|    .|..
plant   138 PKYAKGLVAEV-----SEFLFGSGFAIAEGPLWTARRRAVVPSL---HRRYLSVIVERVFCKCAE 194

  Fly   186 RMVDQWKRRTAEAAAI------------------------------PLAES-------GEIRSYE 213
            |:|::.:....:.:|:                              |:.|:       .|:||.:
plant   195 RLVEKLQPYAEDGSAVNMEAKFSQMTLDVIGLSLFNYNFDSLTTDSPVIEAVYTALKEAELRSTD 259

  Fly   214 LPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRL 278
            |      |..|.|:.||.|:        |: |...:....::.:..|                  
plant   260 L------LPYWKIDALCKIV--------PR-QVKAEKAVTLIRETVE------------------ 291

  Fly   279 PIWRDFEANVDEVL-REGAAIIDHCIRVQEDQRRPHDEALYHRLQAA--DVPGDMIKRIFVDLVI 340
                |..|...|:: |||..|.|      |:.....|.::...|.|:  :|....::...:.:::
plant   292 ----DLIAKCKEIVEREGERIND------EEYVNDADPSILRFLLASREEVSSVQLRDDLLSMLV 346

  Fly   341 AAGDTTAFSSQWALFALSKEPRLQQRLAKERATNDSRLMHG----------------LIKESLRL 389
            |..:||.....|.|:.|||.....::..:|    ..|::.|                .|.||:||
plant   347 AGHETTGSVLTWTLYLLSKNSSALRKAQEE----VDRVLEGRNPAFEDIKELKYITRCINESMRL 407

  Fly   390 YPVAP-FIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCI-----GETE 448
            ||..| .|.|....|...|.:.:.....:::|:|...|....:|:.|..||||:.|     .||.
plant   408 YPHPPVLIRRAQVPDILPGNYKVNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDIDGAIPNETN 472

  Fly   449 QVHKSHGSLPFAIGQRSCIGRRVALKQ----LHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDR 509
            ...|   .:||:.|.|.|:|.:.||.:    |...|.|                  |.:..|||:
plant   473 TDFK---FIPFSGGPRKCVGDQFALMEAIVALAVFLQR------------------LNVELVPDQ 516

  Fly   510 TLRL 513
            |:.:
plant   517 TISM 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 108/507 (21%)
LUT1NP_190881.2 PLN02936 56..539 CDD:178524 113/525 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.