DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP81D6

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_179903.1 Gene:CYP81D6 / 816854 AraportID:AT2G23220 Length:515 Species:Arabidopsis thaliana

Alignment Length:572 Identity:127/573 (22%)
Similarity:219/573 (38%) Gaps:175/573 (31%)


  Fly    25 ILSLS---------LFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGA 80
            :|||:         ||..|     |.:|   .|||:.|         :.||::|           
plant    22 LLSLAFFLFISVKLLFGKR-----LSKF---NLPPSPA---------RPLPLIG----------- 58

  Fly    81 THLHKYIDARHKQY---------GPIFRERLGG-----------------TQDAVFVSSANLMRG 119
             |||......|:.:         .|||..|||.                 ..|.||.:...|:.|
plant    59 -HLHLLKLPLHRTFLSFSQSLGGAPIFCLRLGNRLTVVVSSYSIAEECFTKNDIVFANRPELILG 122

  Fly   120 VFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLL-----LNGNLNWMDVH 179
                     :|...::.|:.:..:          |..|.:.|||....:     |||.|:.....
plant   123 ---------KHIEYNSTTMTSAPY----------GDHWRNLRRIATLEIFASHKLNGFLSVRKDE 168

  Fly   180 IESCTRRMVDQWKRRTAEAAAIPLAESGEIRS--YELPL---------------------LEQQL 221
            |.....|:....:...|:.         |:|.  :||.:                     :.||:
plant   169 IRQLLLRLSKNSRHGFAKV---------EMRHLLFELTINNVFRMVAGKRFYGEGTEQDEVAQQV 224

  Fly   222 YRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEA 286
            .....|::.....|.:....|.::    :||....:|...:.|:..|...|..          |.
plant   225 RHLMDEIVTSAGAGNAADYLPIMR----WFTNFEKRVKNLAIRIDKFLQSLVD----------EK 275

  Fly   287 NVDEVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQ 351
            ..|:  .:|..:|||.:.:||.|  |.    |:    .||   .:|.|.:.::||..:|.|::.:
plant   276 RADK--EKGTTMIDHLLSLQESQ--PD----YY----TDV---TLKGIIIVMIIAGSETIAWTLE 325

  Fly   352 WALFALSKEPRLQQ-------------RLAKERATNDSRLMHGLIKESLRLYPVAPF-IGRYLPQ 402
            ||:..:...|.:.:             ||..|..|.:...:..::.|:|||:|.||. :.....:
plant   326 WAMLNVLNHPEVLKKARTEIDTKIGFDRLMDEADTKNLPYLQWIVLETLRLHPAAPTNVPHSTSE 390

  Fly   403 DAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCI 467
            |..|.|:.:.:.:|:|:::::..||||.:|.||...|||:   :.|::::.  .|.|.:|:|:|.
plant   391 DCMLAGYDVPRGSMLLVNIWSMHRDPSIWEDPEMFKPERF---KNEKLNQK--LLSFGMGRRACP 450

  Fly   468 GRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPRT 519
            |..:|.:.:...||.....||...:.:..||:      ..|:|:.| :||.|
plant   451 GYGLAHRVVSLTLGSMVQCFEWQRIGQEYVDN------SEDKTVVL-MRPTT 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 107/502 (21%)
CYP81D6NP_179903.1 p450 38..510 CDD:299894 122/557 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.