DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and LOC680316

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_017458835.1 Gene:LOC680316 / 680316 RGDID:1593012 Length:425 Species:Rattus norvegicus

Alignment Length:488 Identity:110/489 (22%)
Similarity:187/489 (38%) Gaps:112/489 (23%)


  Fly    47 ELPPAVAAKYVPIP---RVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDA 108
            ::.|.....:..||   |.|.|    .::.::...|..:||..:....::.|||||...||.| .
  Rat    31 KVAPKTLKPFEAIPQYSRNKWL----KMIQILREQGQENLHLEMHQAFQELGPIFRHSAGGAQ-I 90

  Fly   109 VFVSSANLMRGVFQHEGQYPQHPLP-DAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGN 172
            |.|........:.|.|...| |.:| :.|..:.:....:||:|                 |||  
  Rat    91 VSVMLPEDAEKLHQVESILP-HRMPLEPWVAHRELRGLRRGVF-----------------LLN-- 135

  Fly   173 LNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTS 237
                  |:|.                                    ..||..|::          
  Rat   136 ------HLEG------------------------------------HDLYPESLK---------- 148

  Fly   238 VLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHC 302
                         ||..:|.:|..:::|:..|..|.:.....:|:....:.|.:......:..:.
  Rat   149 -------------FTHALHSMFTSTTQLILLPKSLTRWTSTQVWKGHFESWDIISEYVTNVSXNV 200

  Fly   303 IRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRL 367
            .|...:.|:.....:...:..:.:..|.|....::::..:.||||.|....||.|::.|.:||.|
  Rat   201 YRELAEGRQKSWSVISEMVAQSTLSMDAIHANSMEIIAXSVDTTAISLVMTLFELARNPDVQQAL 265

  Fly   368 AKE-------------RATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLL 419
            .:|             :|.:|..|:...:||:||||||..::.|.|..|..|..:.:...|.|::
  Rat   266 QQESLAAEASIAANPQKAISDLPLLRAALKETLRLYPVGSYLERILNSDLVLQNYHVPAGTFVII 330

  Fly   420 SLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCA 484
            .||:.||:|:.|.:|||.:|:||.     :..:|...|.|..|.|.|:|||:|..::..||....
  Rat   331 YLYSMGRNPAVFPRPERYMPQRWL-----ERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMP 390

  Fly   485 AQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRP 517
            ..|::....:..|....|.:.:|.....|..||
  Rat   391 KSFQVETQEKEDVQMAYRFILMPSSIPLLTFRP 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 100/448 (22%)
LOC680316XP_017458835.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.