DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and si:dkey-91i10.3

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001116749.1 Gene:si:dkey-91i10.3 / 565876 ZFINID:ZDB-GENE-081105-124 Length:513 Species:Danio rerio

Alignment Length:494 Identity:122/495 (25%)
Similarity:219/495 (44%) Gaps:80/495 (16%)


  Fly    70 TLVDLIAAGGATHLH-----KYIDARH-------KQYGPIFRERLGGTQDAVFVSSANLMRGVFQ 122
            |:.||......|.|:     .|....|       |.|||:::.:.|... .|.|:||:|:..|.:
Zfish    45 TMDDLDGPSFLTSLYWLFGKGYFQTTHQMQIEHSKIYGPLWKSKYGPLV-IVNVASADLIEQVLR 108

  Fly   123 HEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRM 187
            .||::|.......|..|.:......|.....|.||...|.|||..:|...      |:.:.|..:
Zfish   109 QEGRHPIRTDMPHWRGYRKLRNHAYGPLTEMGPEWQRIRSILNPRMLKPK------HVSNYTNAI 167

  Fly   188 VDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTC--PKIQSSLDY 250
            .........:.|.:...:..::..|:   :..:||:::.|.:..::|.|. :.|  .:|......
Zfish   168 NGVVSDFIEKMAKLKTTKGNDVMVYD---VAGELYKFAFEGISSVLFETR-MGCLNDEIPEETQK 228

  Fly   251 FTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRPHDE 315
            |...|.::|..|..::.||..|...  :|.|:.|           .|:.||..:|.::..:....
Zfish   229 FIFSVGEMFRLSPIVILFPKFLWPY--MPFWKHF-----------VAVWDHLFKVADELVQQKMT 280

  Fly   316 ALYHRLQ-AADVPGDMIKRIFV--------------DLVIAAGDTTAFSSQWALFALSKEPRLQQ 365
            .:..::: .:.|.|:.:..:.:              :|::|..|||:.:..|||:.|::||.:||
Zfish   281 EIQEKVKTGSPVEGEYLTHLLISEQMSFTEVLGSITELLLAGVDTTSNTISWALYHLAREPEIQQ 345

  Fly   366 RLAKE----------RATND---SRLMHGLIKESLRLYPVAPFIGRYLPQ-DAQLGGHFIEKDTM 416
            :|.:|          .:::|   ..|:..:::|:||||||.|...|.:.: :..:|.|...|:|:
Zfish   346 KLHEEVVSVCPGDKTPSSDDITRMPLLKAIVRETLRLYPVVPGNARVVAENEIVVGDHLFPKNTL 410

  Fly   417 VLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHK-SHGSLPFAIGQRSCIGRRVALKQLHSLL 480
            ..|..:....|.:.|..|...||:|| |.|.:|:.: ..||:||..|.|:|:|||||..:::.||
Zfish   411 FHLCHFAVSYDETVFPDPFAFLPQRW-IREQKQLSQHPFGSVPFGFGIRACLGRRVAELEMYLLL 474

  Fly   481 GRCAAQFEMSCLNEMP------VDSVLRMVTVPDRTLRL 513
            .|...::|:     .|      |..:.|.:.||..::.|
Zfish   475 SRLIKRYEV-----RPDPSGKTVKPITRTLLVPATSIDL 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 117/477 (25%)
si:dkey-91i10.3NP_001116749.1 p450 52..510 CDD:278495 119/488 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13167621
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.