DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4p1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster

Alignment Length:570 Identity:124/571 (22%)
Similarity:220/571 (39%) Gaps:124/571 (22%)


  Fly    13 WLRHLLDQLL---------VRILSLSLFRSRC-DPPPLQRFPATELPPAVAAKYVPIPRVKGLPV 67
            ||...|..||         ..|||....|.|. |..|::               :..|..||..:
  Fly     5 WLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVE---------------IIAPIAKGKTI 54

  Fly    68 VGTLVDLIAAGGATH--LHKYIDARHKQYGPIFRERLGGTQDAVF-VSSANLMRGVFQHEGQYPQ 129
            .|..:||.   |..|  :..|...|.|:.|..:.|.:.|  .|:: :..|:....|..|      
  Fly    55 FGNTLDLY---GRDHAGVFNYSRERAKEMGTSYIEYVFG--KAIYNIIDADSAENVLNH------ 108

  Fly   130 HPLPDAWT---LYNQQHACQR-GLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQ 190
               |:..|   :||..|...| ||....|.:|...|::|........||......::.:::.:.|
  Fly   109 ---PNLITKGLVYNFLHPFLRTGLLTSTGKKWHARRKMLTPTFHFNILNQFQEIFKTESQKFLLQ 170

  Fly   191 WKRRTAEAAAIPLAESGEIRSYELPL-LEQQLYRWSIEVLCCIMFGTSV-LTCPKIQSSLDYFTQ 253
            ::.:.                 |:.: |...:.|:::..:|....|..: ....|.....:.|:|
  Fly   171 FEGQD-----------------EVTITLHDVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFSQ 218

  Fly   254 IVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRP--HDEA 316
            |........|..:.:..:|.::...   :||.:.:|.|.|..:.||        .:||.  .|| 
  Fly   219 IEECFIRRLSNPLLWGDKLFEMFAA---KDFASALDVVHRFSSEII--------AKRRDLLKDE- 271

  Fly   317 LYHRLQAADVPGDMIKRIF-----------------------VDLVIAAG-DTTAFSSQWALFAL 357
            |......||..|.:.|:.|                       ||.::..| |||:....:.|..:
  Fly   272 LDKSSSTADDDGFVSKKRFAMLDTLIYAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNM 336

  Fly   358 SKEPRLQQRLAKE--------------RATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQL-G 407
            |..|..|:...:|              ...|..:.:...:||:.||:|..|.:||...|:.:| .
  Fly   337 SLNPDKQELCYQEIQEHIDDDLSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELAN 401

  Fly   408 GHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVA 472
            |..:.|...:.:.::...|:..:::.||...|||: :.|..|...::..:||:.|||:|||::.|
  Fly   402 GLILPKGAQITIHVFDIHRNAKYWDSPEEFRPERF-LPENVQDRHTYAYVPFSAGQRNCIGKKYA 465

  Fly   473 LKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRT---LRLALRPRT 519
            ::::.:|:.....||::  |..:....::....:..||   :|:.|..||
  Fly   466 MQEMKTLMVVLLKQFKV--LKAIDPQKIVFHTGITLRTQDKIRVKLVRRT 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 105/484 (22%)
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 106/501 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.