DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and dib

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster

Alignment Length:556 Identity:139/557 (25%)
Similarity:230/557 (41%) Gaps:123/557 (22%)


  Fly    21 LLVRILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGA---TH 82
            :|.::|.:|....:|               ..|..|..||..:|...:|.|.:.:...|:   ..
  Fly     1 MLTKLLKISCTSRQC---------------TFAKPYQAIPGPRGPFGMGNLYNYLPGIGSYSWLR 50

  Fly    83 LHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHA--- 144
            ||:....::::||.|.||.:...||.|::.....: .:..:|...||.....|...|.:...   
  Fly    51 LHQAGQDKYEKYGAIVRETIVPGQDIVWLYDPKDI-ALLLNERDCPQRRSHLALAQYRKSRPDVY 114

  Fly   145 CQRGLFFMEGAEWLHNR-RILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGE 208
            ...||....|.||...| ::...|....::......::..|:..: ::.:.:....||.:     
  Fly   115 KTTGLLPTNGPEWWRIRAQVQKELSAPKSVRNFVRQVDGVTKEFI-RFLQESRNGGAIDM----- 173

  Fly   209 IRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLM-----TF 268
                 ||    :|.|.::|:.|.:.||.      ::||    ||.........|:|||     |.
  Fly   174 -----LP----KLTRLNLELTCLLTFGA------RLQS----FTAQEQDPRSRSTRLMDAAETTN 219

  Fly   269 PPRLAQILRLPIWRDFEAN-------------------VDEVLRE---GAAIIDHCIRVQEDQRR 311
            ...|.....|.:||..|..                   |:|.:|.   |:::|...::..|    
  Fly   220 SCILPTDQGLQLWRFLETPSFRKLSQAQSYMESVALELVEENVRNGSVGSSLISAYVKNPE---- 280

  Fly   312 PHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRL--------- 367
                     |..:||.|..     .||::|..|||:::|.:.|:.:::.|.:||:|         
  Fly   281 ---------LDRSDVVGTA-----ADLLLAGIDTTSYASAFLLYHIARNPEVQQKLHEEARRVLP 331

  Fly   368 -AKERATNDS-----RLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGR 426
             ||:..:.|:     .....::||||||.|:|..:||.|.|||...|:|:.|.|.|:.....|.|
  Fly   332 SAKDELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDAIFSGYFVPKGTTVVTQNMVACR 396

  Fly   427 DPSHFEQPERVLPERWCIGETEQVHKS----HGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQF 487
            ...||:.|.|..|:||.      .|:|    :..|||..|.|:||.||:|.:.:|.||.|...::
  Fly   397 LEQHFQDPLRFQPDRWL------QHRSALNPYLVLPFGHGMRACIARRLAEQNMHILLLRLLREY 455

  Fly   488 EM---SCLNEMPVDSVLRMVTVPDRTLRLALRPRTE 520
            |:   ...:||.|.::|  :..||..:.:.||.|.|
  Fly   456 ELIWSGSDDEMGVKTLL--INKPDAPVLIDLRLRRE 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 123/490 (25%)
dibNP_524810.2 p450 25..446 CDD:299894 118/471 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.