DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp27b1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001006907.1 Gene:cyp27b1 / 448754 XenbaseID:XB-GENE-942527 Length:506 Species:Xenopus tropicalis

Alignment Length:497 Identity:125/498 (25%)
Similarity:216/498 (43%) Gaps:78/498 (16%)


  Fly    64 GLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYP 128
            |...|..:.||....|...||:.......::||:::...|... .|.|:..:|:..|.:.||::|
 Frog    46 GPSTVSFISDLFCRRGLARLHELQLEGKAKFGPVWKASFGPIL-TVHVAEPSLIEQVLRQEGKHP 109

  Fly   129 QHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKR 193
            ......:|..|.|......||...||.||...|.||.:.:|                      |.
 Frog   110 IRSDLSSWKDYRQCRGHSYGLLTAEGEEWQQFRSILGKHML----------------------KP 152

  Fly   194 RTAEAAAIPLAE-SGEI-------RSYE----LPLLEQQLYRWSIEVLCCIMFGTSVLTC--PKI 244
            :..||.:..|.: .|::       ||..    :..:.::.|.:.:|.:..::| .|.:.|  |.:
 Frog   153 KEVEAYSDVLNDVVGDLIKKINYQRSQNQNNVVKDIAKEFYMFGLEGISSVLF-ESRIGCLEPTV 216

  Fly   245 QSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDF-----------EANVDEVLREGAAI 298
            ....:.|.|.::.:|..:...|..|..|.:|.|.| |:.|           :.::|:.:::.|..
 Frog   217 PKETEKFIQSINTMFVMTLLTMAMPKFLHKIFRKP-WQKFCESWDYMFAFAKGHIDKRMKDVAQK 280

  Fly   299 IDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRL 363
            :....:|:       .:.|.:.|....:|...|.....:|::|..||.:.:..|:|:.|::.|.:
 Frog   281 LAQGEKVE-------GKYLTYYLAQEKIPMKSIYGNVTELLLAGVDTISSTLSWSLYELAQHPDI 338

  Fly   364 QQRLAKE-----------RATNDSR--LMHGLIKESLRLYPVAPFIGRYL-PQDAQLGGHFIEKD 414
            |..:..|           ..::.:|  |:..::||.||||||.|...|.: .:|.|:|.:.|.|.
 Frog   339 QSAVYSEVEEILQGKQIPSPSDVARMPLLKAVVKEVLRLYPVIPGNARVVADRDIQVGDYIIPKK 403

  Fly   415 TMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSL 479
            |::.|..|...||.:.|..|....|:||.  :.|..|..:.||||..|:|||||||:|..:::..
 Frog   404 TLITLCHYATSRDENVFSNPNEFQPDRWL--KKEDTHHPYASLPFGFGKRSCIGRRIAELEVYLA 466

  Fly   480 LGRCAAQFEMSCLNEMPVDSVL---RMVTVPDRTLRLALRPR 518
            |.|..:.||:.  .|.|...|:   |.:.||::.:.|....|
 Frog   467 LARILSHFEVK--PEQPGSLVMPMTRTLLVPEKEINLQFLER 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 119/472 (25%)
cyp27b1NP_001006907.1 p450 45..503 CDD:306555 124/493 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13168908
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.