DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp12e1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster

Alignment Length:528 Identity:122/529 (23%)
Similarity:199/529 (38%) Gaps:131/529 (25%)


  Fly    44 PATELP-PA---VAAKYVPIPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFR-ERLG 103
            |..::| |:   :...::|....|.|||....:|:                ::|||.||| ..:.
  Fly    37 PYADIPGPSKLQLIRAFLPGGLYKNLPVHEMFLDM----------------NRQYGSIFRMPSVA 85

  Fly   104 GTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQ-----RGLFFMEGAEWLHNRRI 163
            || |.|...:......:|::|||||.....:....:.:.|..:     .||....|..|...|..
  Fly    86 GT-DLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFDGYDGLTSGNGPAWGKMRTA 149

  Fly   164 LNRLLL---NGNL---NWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQ--- 219
            :|.:||   |..|   |.:.|..|...|                       ||....|:.::   
  Fly   150 VNPILLQPRNAKLYMTNLVQVSDEFLER-----------------------IRIIRDPVTQEMPD 191

  Fly   220 ----QLYRWSIEVLCCIMFGTSVLTCPKIQSSLDY------FTQIVHKVFEHSSRLMTFPPRLAQ 274
                .:....||.:|.:...|.:....:.:::.|.      ...:|...|:     :...|...:
  Fly   192 DFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQ-----LDIMPAFWK 251

  Fly   275 ILRLPIWRDFEANVDEVLREGAAIIDHCI--------RVQEDQRRPH------DEALYHRLQAAD 325
            .|.:|       |..:::|....|.|.|.        |::||.:...      :.:|..:|...|
  Fly   252 YLPMP-------NFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTLNEIGLETSLLEKLARFD 309

  Fly   326 VPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE----RATNDSRL-------- 378
            ....:|  |.:||:.|..|.|..:....||:|||.|..|.||.:|    ....||.|        
  Fly   310 RQTAVI--IAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRGILPNKDSSLTIENMRNL 372

  Fly   379 --MHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQ--PE--RV 437
              :...|||.:|:||:.|...|.:|.|..|.|:.:...|.|.::   |....::.||  |:  ..
  Fly   373 PYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGTDVGIA---ANYQMANMEQFVPKVREF 434

  Fly   438 LPERW--------CIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNE 494
            :||||        .:|||.....   .|||..|.|||.|:|:....|...:.|....|::..  :
  Fly   435 IPERWLRDESNSHLVGETATPFM---YLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKIGF--D 494

  Fly   495 MPVDSVLR 502
            .|:::..:
  Fly   495 YPIENAFK 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 118/499 (24%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 116/503 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.