DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp27a7

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_002663445.1 Gene:cyp27a7 / 402831 ZFINID:ZDB-GENE-081104-519 Length:524 Species:Danio rerio

Alignment Length:496 Identity:134/497 (27%)
Similarity:231/497 (46%) Gaps:62/497 (12%)


  Fly    59 IPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQ-YGPIFRERLGGTQDAVFVSSANLMRGVFQ 122
            :|.:|   :...|..|:..|..:.:|: :....|| |||:::..:|..| :|.::|.:|:..:.:
Zfish    56 LPEIK---IFTMLYRLLFKGYLSRMHE-LQLYEKQLYGPLYKINVGNFQ-SVALNSVDLLEELLR 115

  Fly   123 HEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLN--GNLNWMDVHIESCTR 185
            .:.::|.......||.|........|.|..||.:|...|.:||:.:|:  .::.:.||     ..
Zfish   116 KDEKFPSRGDMTLWTEYRDMKGIGYGPFTEEGEKWYKLRAVLNKRMLHPKDSVQYGDV-----VN 175

  Fly   186 RMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPK-IQSSLD 249
            .::..:.:|.....  .::.:|::.|.    |..:|||:|:|.:..|:|.|.:....| |.:...
Zfish   176 AVITDFIKRIYYLR--EMSPTGDLVSN----LTNELYRFSLEGISSILFETRIGCLEKEIPAETQ 234

  Fly   250 YFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCI-----RVQEDQ 309
            :|...:.::..:|..::..|......  ||.|:.:....|.:.:....:||..:     ||..:|
Zfish   235 HFINSIAQMLTYSMPVVFMPNWTRNY--LPFWQRYIGGWDGIFKFAGKMIDMKMEALQKRVDANQ 297

  Fly   310 RRPHDEALY----HRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE 370
            ....:...|    .::.:.||.|.:     .:|::|..|||:.:..:||:.|||:|..|..|.:|
Zfish   298 EVAGEYLTYLLSNGKMSSKDVYGSV-----SELLLAGVDTTSNTMLFALYHLSKDPETQDILYQE 357

  Fly   371 RATN---DSRL-----------MHGLIKESLRLYPVAPFIGRYLPQ-DAQLGGHFIEKDTMVLLS 420
             .||   |.|:           :..:|||:||||||.|...|.:.: :..:|||...|:|...|.
Zfish   358 -VTNVLKDDRIPTAQEVNTMSYLKAVIKETLRLYPVVPMNARLIAENEVVIGGHLFPKNTTFTLC 421

  Fly   421 LYTAGRDPSHFEQPERVLPERWC-IGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCA 484
            .|...||...|.:|::..||||. .|.|..  ...||:||..|.|.|:|||:|..:::..|.|..
Zfish   422 HYAISRDEKVFPEPQKFKPERWLRDGRTRP--NPFGSIPFGFGVRGCVGRRIAELEMYLALARLI 484

  Fly   485 AQFEM---SCLNEMPVDSVLRMVTVPDRTLRLAL--RPRTE 520
            ..||:   ..:.|  |.|:.|.|..|||.:.|..  |.:||
Zfish   485 KLFEIRPDPTVGE--VRSLNRTVLAPDRKVNLHFVERKKTE 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 122/466 (26%)
cyp27a7XP_002663445.1 p450 68..507 CDD:278495 124/464 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13169205
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127298
Panther 1 1.100 LDO PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.