DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp312a1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001262008.1 Gene:Cyp312a1 / 40005 FlyBaseID:FBgn0036778 Length:510 Species:Drosophila melanogaster

Alignment Length:566 Identity:124/567 (22%)
Similarity:201/567 (35%) Gaps:168/567 (30%)


  Fly    25 ILSLSLF-------RSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGAT- 81
            :|:|||:       :||.| ....::||   |||       :|.:..|.::..||.......|| 
  Fly    10 LLALSLYLLYVFERQSRID-RLTHKWPA---PPA-------LPFIGHLHILAKLVGPHPLRRATE 63

  Fly    82 ----HLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQ 142
                |||   |.|.|.:        .||:  :::...|            |:    |...|.:.|
  Fly    64 MINEHLH---DHRAKLW--------MGTK--LYLVDCN------------PK----DIQALCSAQ 99

  Fly   143 HACQR-------------GLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQW--- 191
            ...|:             |||.....:|.|.|:|:               :.:....|:.|:   
  Fly   100 QLLQKTNDYRVFENWLCEGLFTSGFEKWSHRRKIV---------------MPAFNYTMIKQFVAV 149

  Fly   192 ---KRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSL--DYF 251
               :.|.........||||:    ::..| |.:..::::.:|....|.||.:    |||.  :|.
  Fly   150 FEKQSRILLTNVAKFAESGD----QIDFL-QLISCFTLDTICETALGVSVGS----QSSAKSEYL 205

  Fly   252 TQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEAN------------VDEVLREGAAIIDHCIR 304
            ..:       .|.|:....||..|        |..|            ..|:::......:..|:
  Fly   206 DAV-------KSILVIIDKRLKNI--------FYRNSFIFKRTSHYKREQELIKTLHGFTEGIIQ 255

  Fly   305 VQEDQRRPHDEALYHRLQAADVPGDMIKRIF-------------------------VDLVIAAG- 343
            .:.|:  .:.:|.....|::|...|.:||..                         ||.:|..| 
  Fly   256 KRIDE--INQDAENRNYQSSDAELDGVKRTLCFLDTLLLSKGPDGKPLTVKDIREEVDTIIFGGF 318

  Fly   344 DTTAFSSQWALFALSKEPRLQQRLAKE---------------RATNDSRLMHGLIKESLRLYPVA 393
            |.||.:..:.::.::..|..|||..:|               ........:...|||:||:||..
  Fly   319 DLTATTLNFFMYNMTLHPEHQQRCREEVWSVCGKDKSEPISIEQVRQLEFLEACIKETLRMYPSG 383

  Fly   394 PFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLP 458
            |...|....:..:...||.|.:.|::|....||....|..|....|:||.||...:: ::...:|
  Fly   384 PLTARKATANCTINDFFIPKGSDVIISPIYMGRCKDFFPDPMVFKPDRWAIGAEPKI-EATTFIP 447

  Fly   459 FAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMV 504
            |..|.|||:|:|.|:..|..:|......|....|.|..|...|..|
  Fly   448 FMAGARSCMGQRYAMVMLKMVLAHLLRNFLFEPLGERQVKLKLNFV 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 108/513 (21%)
Cyp312a1NP_001262008.1 p450 35..505 CDD:278495 117/541 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.