DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4d8

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_523961.1 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:463 Species:Drosophila melanogaster

Alignment Length:466 Identity:99/467 (21%)
Similarity:172/467 (37%) Gaps:127/467 (27%)


  Fly   122 QHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRIL---------------------- 164
            :|..::|.:.:...| |.|       ||...:|..|...|:|:                      
  Fly    53 EHLVKHPVYKVLGQW-LGN-------GLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNI 109

  Fly   165 --NRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPL-----------AESGEIRSYELPL 216
              .||....|.|..||:...|              |||:.:           |::.|...|...:
  Fly   110 CVQRLAQKANGNTFDVYRSIC--------------AAALDIIAETAMGTKIYAQANESTPYAEAV 160

  Fly   217 LE-QQLYRW---SIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILR 277
            .| ..|..|   |:.:...::|   .||.|.::.                        |..|::|
  Fly   161 NECTALLSWRFMSVYLQVELLF---TLTHPHLKW------------------------RQTQLIR 198

  Fly   278 LPIWRDFEANVDEVLREG-----AAIIDHCIRVQEDQRRPHDEALYHRLQAADVPG-----DMIK 332
              ..::|...|.|..|:.     :.::|   ...||.......||...|..:.|.|     |.|:
  Fly   199 --TMQEFTIKVIEKRRQALEDQQSKLMD---TADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIR 258

  Fly   333 RIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE---------------RATNDSRLMHGL 382
            ......:....|||..:..:.|..||:.|.:|.::.:|               |...:.:.|..:
  Fly   259 EEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECV 323

  Fly   383 IKESLRLYPVAPFIGRYLPQDAQL-----GGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERW 442
            ||||||:||..|.:||.|..|.:.     |...|...:.:::.::...|.|..|..|:..:|||.
  Fly   324 IKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERH 388

  Fly   443 CIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVP 507
            ..|......|   .:||:.|.|:|||::.|..::..:|.:...::|:..:.:. |:.::.:|...
  Fly   389 ENGSRVAPFK---MIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR-VECIVNIVLRS 449

  Fly   508 DRTLRLALRPR 518
            :...:|.:|.|
  Fly   450 ETGFQLGMRKR 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 94/444 (21%)
Cyp4d8NP_523961.1 p450 22..457 CDD:278495 97/462 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.