DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sad and Cyp12b2

Sequence 1:NP_650123.1 Gene:sad FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:547 Identity:113/548 (21%)
Similarity:202/548 (37%) Gaps:109/548 (20%)


  Fly    28 LSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGA---THLHKYIDA 89
            |.|..||.|....|.....|:|.               |.:..::.....|||   |:|.:....
  Fly    36 LELADSRIDEKWQQARSFGEIPG---------------PSLLRMLSFFMPGGALRNTNLIQMNRL 85

  Fly    90 RHKQYGPIF-RERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQ-----RG 148
            ..:.||.|: ...:.|..:|||..:.:.....:::||.:|.....::...|.:.|...     .|
  Fly    86 MREMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGG 150

  Fly   149 LFFMEGAEWLHNRRILNRLLLN-GNLNWMDVHIESCTRRMVDQWK-RRTAEAAAIPLAESGEIRS 211
            |...:|.||...|..:|.:|:. .|:......::..::..:|:.: :|..|...:...       
  Fly   151 LASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTD------- 208

  Fly   212 YELPLLEQQLYRWSIEVLCCIMFGTSV-LTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQI 275
                 ...||..|:.|.:..:...|.: |.......:.|...:.:...|.:|.:....|      
  Fly   209 -----FHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQP------ 262

  Fly   276 LRLPIW------------------RDFEANVDEVLREGAAIID----HCIRVQEDQRRPHDEALY 318
               .||                  .|..:|..|....|....|    .|:.         ::.|.
  Fly   263 ---SIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVL---------EQLLE 315

  Fly   319 HRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE------------- 370
            |..:.|       ..:.:|:::|..|||:.:....|:.|::.|..|::|.:|             
  Fly   316 HNKKVA-------VTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLT 373

  Fly   371 -RATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQP 434
             :.|.:...:...|||.||:..:.|...|..|:|..|.|:.:.:.|.||:.:.....|..:|.|.
  Fly   374 DQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQS 438

  Fly   435 ERVLPERWCIGE---------TEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMS 490
            ...:||||...:         ..:.......|||..|.|:|||:|:|..::.:||.|....:::|
  Fly   439 SEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVS 503

  Fly   491 CLNEMPVDSVLRMVTVPDRTLRLALRP 517
            .|.|.|::....::..|...:|..|.|
  Fly   504 WLPETPIEYESTIILSPCGDIRFKLEP 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 101/491 (21%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 101/489 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.