DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp49a1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster

Alignment Length:532 Identity:129/533 (24%)
Similarity:220/533 (41%) Gaps:109/533 (20%)


  Fly    25 ILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGT---LVDLIAAGGATHLHKY 86
            :.|::..|:.....|.:   .|..|.|....|..:|....||::|.   ...||.....:.|.|.
  Fly    72 VTSVATTRTTASSLPAE---TTSSPAAAVRPYSEVPGPYPLPLIGNSWRFAPLIGTYKISDLDKV 133

  Fly    87 IDARHKQYGPIFRERLGGT---QDAVFVSSANLMRGVFQHEGQYPQHP-LPDAWTLYNQQHACQR 147
            ::..|..||.:  .::||.   .|.:||...:.:|.:|:.|...|..| :|   :|.:.:...:|
  Fly   134 MNELHVNYGKM--AKVGGLIGHPDLLFVFDGDEIRNIFKKEEAMPHRPSMP---SLRHYKGDLRR 193

  Fly   148 -------GLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAE 205
                   ||..:.|.:|...|:.:..:||                      :.:||:....||.:
  Fly   194 DFFGDVAGLIGVHGPKWEAFRQEVQHILL----------------------QPQTAKKYIPPLND 236

  Fly   206 -----SGEI-----RSYELPL-LEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVF 259
                 .|.|     ...|||. ...:||:|::|.:..:...|. |.|...:.|     :...::.
  Fly   237 IASEFMGRIELMRDEKDELPANFLHELYKWALESVGRVSLDTR-LGCLSPEGS-----EEAQQII 295

  Fly   260 EHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDH----CIR--VQEDQRRPHDEALY 318
            |..:......|.|.  ||:|:||.:..   :..|.....:|.    |::  .:...:...|||..
  Fly   296 EAINTFFWAVPELE--LRMPLWRIYPT---KAYRSFVKALDQFTAICMKNIGKTMDKADADEARG 355

  Fly   319 HRLQAADVPGDMIKRIF-------------VDLVIAAGDTTAFSSQWALFALSKEPRLQQRL--- 367
            .....||:  .:::||.             :||.:...|||:.::...::.|:|.|..|::|   
  Fly   356 LSKSEADI--SIVERIVRKTGNRKLAAILALDLFLVGVDTTSVAASSTIYQLAKNPDKQKKLFDE 418

  Fly   368 ------AKERATNDSRL-----MHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSL 421
                  .:|...|.:.|     :...:||:||:.||....||.|..||.:.|:.:.|.|.|:...
  Fly   419 LQKVFPHREADINQNVLEQMPYLRACVKETLRMRPVVIANGRSLQSDAVINGYHVPKGTHVIFPH 483

  Fly   422 YTAGRDPSHFEQPERVLPERWCIGETEQVHKSHG--------SLPFAIGQRSCIGRRVALKQLHS 478
            .....||::|.:|:|.|||||....|:.....|.        ||||..|:|.|:|||.|..:||:
  Fly   484 LVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHANQKIHPFVSLPFGFGRRMCVGRRFAEIELHT 548

  Fly   479 LLGRCAAQFEMS 490
            ||.:...::::|
  Fly   549 LLAKIFRKYKVS 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 121/495 (24%)
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 122/498 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127298
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.