DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4d21

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster

Alignment Length:530 Identity:122/531 (23%)
Similarity:215/531 (40%) Gaps:124/531 (23%)


  Fly    61 RVKG---LPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFR-----ERLGGTQDAVF----VSS 113
            |:.|   :|:||..:..:.......:.::.|..:| ||..||     |.|..|:|..:    :||
  Fly    32 RILGPFTIPIVGNGLQALTLRPENFIQRFGDYFNK-YGKTFRLWILGECLIYTKDLKYFESILSS 95

  Fly   114 ANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDV 178
            :.|::..  |..::.:..|.|             ||....|.:|...|::|....   :...::.
  Fly    96 STLLKKA--HLYRFLRDFLGD-------------GLLLSTGNKWTSRRKVLAPAF---HFKCLEN 142

  Fly   179 HIESCTRR---MVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLT 240
            .:|...|.   ||::.|........:.|        ::...||      :::|......|..|..
  Fly   143 FVEIMDRNSGIMVEKLKNYADGKTCVDL--------FKFVSLE------ALDVTTETAMGVQVNA 193

  Fly   241 CPKIQSSLDYFTQIVHKVFEHSSRLMT--------FPPRLAQILR-----LPIWRDFEANVDEVL 292
              :.:.:..|...:...|:..|.||.:        ||.....:.|     :.|.:||   .|:|:
  Fly   194 --QNEPNFPYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQDF---TDKVI 253

  Fly   293 REGAAIIDHCIRVQEDQRRPHDEALYHRLQAA--DVPG---------------------DMIKRI 334
            ||..||::          |...:..|..|...  |:.|                     |:..|.
  Fly   254 RERRAILE----------RARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIRE 308

  Fly   335 FVDLVIAAG-DTTAFSSQWALFALSKEPRLQQRLAKE----------RATNDSRLMH-----GLI 383
            .||:.|.|| |||......||.|:|:.|::|:.:.:|          .:...::|:.     .:|
  Fly   309 EVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVI 373

  Fly   384 KESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETE 448
            ||::||:|..|.:|||:|:|.::|...|..:|.:||..|...|||.:|..|....||||...:|.
  Fly   374 KETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEYFPDPLVFKPERWMDMKTT 438

  Fly   449 QVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLR----MVTVPDR 509
            ........:||:.|.::|||::.|..|:.:|:.:....:|:     :|:.:.|:    .:.....
  Fly   439 SNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYEL-----LPLGADLKATYTFILSSST 498

  Fly   510 TLRLALRPRT 519
            ...:.|:|||
  Fly   499 GNNVGLKPRT 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 116/501 (23%)
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 116/500 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.