DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP27C1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001354431.1 Gene:CYP27C1 / 339761 HGNCID:33480 Length:537 Species:Homo sapiens

Alignment Length:553 Identity:139/554 (25%)
Similarity:230/554 (42%) Gaps:133/554 (24%)


  Fly    21 LLVRILSLSLFRS------------RCDPPPLQRFPA--------------------TELPPAVA 53
            ||.|||...|..:            |...|...|.||                    .|.|.::|
Human     3 LLARILRAGLRPAPERGGLLGGGAPRRPQPAGARLPAGARAEDKGAGRPGSPPGGGRAEGPRSLA 67

  Fly    54 AKYVPIPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMR 118
            |  :|.||     .:..|.:.....|.:.:|:......::||.||:... |.|..|.::..:::.
Human    68 A--MPGPR-----TLANLAEFFCRDGFSRIHEIQQKHTREYGKIFKSHF-GPQFVVSIADRDMVA 124

  Fly   119 GVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIES- 182
            .|.:.||..||....::|..|........||...||.:||..|.:|.:.:|...    ||.|.| 
Human   125 QVLRAEGAAPQRANMESWREYRDLRGRATGLISAEGEQWLKMRSVLRQRILKPK----DVAIYSG 185

  Fly   183 -CTRRMVDQWKRRTAEAAAIPL----AESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCP 242
             ..:.:.|..||       |.|    ||.||    .:..:....:::|:|.:..|:: .|.|.| 
Human   186 EVNQVIADLIKR-------IYLLRSQAEDGE----TVTNVNDLFFKYSMEGVATILY-ESRLGC- 237

  Fly   243 KIQSSLDYFT-------QIVHKVFEHSSRLMTFPPRLAQILRLPIWRDF-----------EANVD 289
             :::|:...|       :::..:|:.|......|..|...:..| ||:|           :.:||
Human   238 -LENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKP-WREFCRSWDGLFKFSQIHVD 300

  Fly   290 EVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFV--------------DLVI 340
            ..||:        |:.|.|:.|             .|.|.::..:|:              ::::
Human   301 NKLRD--------IQYQMDRGR-------------RVSGGLLTYLFLSQALTLQEIYANVTEMLL 344

  Fly   341 AAGDTTAFSSQWALFALSKEPRLQQRLAKERATNDSR-------------LMHGLIKESLRLYPV 392
            |..|||:|:..|.::.|::.|.:||.:.:|...|...             |:..|:||:|||:||
Human   345 AGVDTTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLKETLRLFPV 409

  Fly   393 APFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWC-IGETEQVHKSHGS 456
            .|..||...:|..:||:.|.|.|.:.|..|.......:|.:.:...||||. .|:.::| .:.||
Human   410 LPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRV-DNFGS 473

  Fly   457 LPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEM 489
            :||..|.|||||||:|..::|.::.:....||:
Human   474 IPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEI 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 121/480 (25%)
CYP27C1NP_001354431.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13166679
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127298
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.