DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4s3

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster

Alignment Length:537 Identity:127/538 (24%)
Similarity:210/538 (39%) Gaps:130/538 (24%)


  Fly    40 LQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGG 104
            ||||..| ||.               |.:|.|:..:..|...:..|.:..:|   ||:||...|.
  Fly    28 LQRFAKT-LPG---------------PTIGELIANVKKGEILNWLKELREKH---GPVFRIWFGK 73

  Fly   105 TQDAVFVSSANL--MRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRL 167
            ....:|....::  :.|..|...:...:.|.:.|        ..:||....|..| |.||   :|
  Fly    74 DLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPW--------LGKGLLTNGGESW-HRRR---KL 126

  Fly   168 LLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPL--------AESGEIRSYELPLLEQQLYRW 224
            |..|      .|.     |::.::|....|...|.:        .||.:|..|        :..:
  Fly   127 LTPG------FHF-----RILSEFKEPMEENCRILVRRLRTKANGESFDIYPY--------ITLF 172

  Fly   225 SIEVLCCIMFGTSVLTCPKIQSSLDY------FTQIVHK----------VF--------EHSSRL 265
            :::.:|....|  :....::||..:|      ..:::||          ||        |..:.|
  Fly   173 ALDAICETAMG--IKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAAL 235

  Fly   266 MTFPPRLAQILRL---------PIWRDFEANVDEV-LREGAAIIDHCIRVQEDQRRPHDEALYHR 320
            ........:::||         ..|:. ||..|:| .:...|.:|..:..|.:...        .
  Fly   236 KVLHDETNRVIRLRREQLIQERNEWKP-EAEQDDVGAKRRLAFLDMLLLTQMEGGA--------E 291

  Fly   321 LQAADVPGDMIKRIFVDLVIAAG-DTTAFSSQWALFALSKEPRLQQRLAKERATNDSR------L 378
            |...|:      |..||..:..| |||:.:..:||..|||.|.:|||..:|.:..:.|      .
  Fly   292 LSDTDI------REEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPY 350

  Fly   379 MHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWC 443
            :..:|||:||:||..||..|.:.:|.::|...:.|...:...:|...|||.:|..|||..|:|:.
  Fly   351 LEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFL 415

  Fly   444 IGETEQVHKSHGSLPFAI-----GQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRM 503
            :.| :|:|      |||.     |.|:|||::.|:.:|.:.|......:......:.....:..:
  Fly   416 VNE-KQMH------PFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAEL 473

  Fly   504 VTVPDRTLRLALRPRTE 520
            ||.....:||.:.||.|
  Fly   474 VTKSGNGIRLRILPRDE 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 113/490 (23%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 115/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.