DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4g15

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster

Alignment Length:574 Identity:122/575 (21%)
Similarity:216/575 (38%) Gaps:159/575 (28%)


  Fly    59 IPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFV---SSANLMRGV 120
            :|..:|||:||.|.|:|  |.|:.:.:.:..:...:..|.:..: |.:..||:   ....|:...
  Fly    46 LPGPRGLPIVGHLFDVI--GPASSVFRTVIRKSAPFEHIAKMWI-GPKLVVFIYDPRDVELLLSS 107

  Fly   121 FQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIE---S 182
            ..:..:..::.....|        ...||....|.:|..:|:::....   :||.:...||   .
  Fly   108 HVYIDKASEYKFFKPW--------LGDGLLISTGQKWRSHRKLIAPTF---HLNVLKSFIELFNE 161

  Fly   183 CTRRMVDQWKRRTAEAAAIPLAESGEIRSYELP----------LLEQQL-------------YRW 224
            .:|.:|.:.:           ||.|  |:::..          |||..:             |..
  Fly   162 NSRNVVRKLR-----------AEDG--RTFDCHDYMSEATVEILLETAMGVSKKTQDKSGFEYAM 213

  Fly   225 SIEVLCCIMFGTS---------VLTCPKIQSSLDYFTQIVH----KV-------FEHSSRLMTFP 269
            ::..:|.|:....         |.|..:..........|:|    ||       ||..:|     
  Fly   214 AVMRMCDILHARHRSIFLRNEFVFTLTRYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGTR----- 273

  Fly   270 PRLAQ--ILRLPIWRDFEAN--VDEVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDM 330
            ..|||  :....:.|:.|.|  ||:.  ...|..|...| ::|:.:....|.....|:|.:..|:
  Fly   274 GSLAQCELKAAALEREREQNGGVDQT--PSTAGSDEKDR-EKDKEKASPVAGLSYGQSAGLKDDL 335

  Fly   331 ---------IKRI-FVDLVIAAG-----------------------DTTAFSSQWALFALSKEPR 362
                     .||: |:||::.:.                       ||||..|.:.|..:.....
  Fly   336 DVEDNDIGEKKRLAFLDLMLESAQNGALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQD 400

  Fly   363 LQQRLAKE--------------RATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQL--GGHFI 411
            :|.|:..|              :.|.:.:.:...:.|:||:||..|.|.|.|.:|.:|  |.:.|
  Fly   401 IQDRVLAELDSIFGDSQRPATFQDTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVI 465

  Fly   412 EKDTMVLLSLYTAGRDPSHFE-----QPERVLPERWCIGETEQVHKS-HGSLPFAIGQRSCIGRR 470
            .:...|.::.....|:|..:.     .|:..||||       |.::. :..:||:.|.|||:||:
  Fly   466 PRGATVTVATVLLHRNPKVYANPNVFDPDNFLPER-------QANRHYYAFVPFSAGPRSCVGRK 523

  Fly   471 VALKQLHSLLGRCAAQFEM-SCLNE----MPVDSVLRMVTVPDRTLRLALRPRT 519
            .|:.:|..||......:.: |.|.|    :..|.:|:.    :...|:.|:|||
  Fly   524 YAMLKLKILLSTILRNYRVYSDLTESDFKLQADIILKR----EEGFRVRLQPRT 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 114/547 (21%)
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 112/537 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.