DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4d2

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster

Alignment Length:514 Identity:120/515 (23%)
Similarity:215/515 (42%) Gaps:98/515 (19%)


  Fly    59 IPRVKGLPVVGTLVDLIAAG-GATHLHKYIDARHKQYGPIFR----ERLG----GTQDAVFVSSA 114
            :|..:.||.:|.|  |:..| ....:..::....::||.::|    .:|.    ..:|..||.|:
  Fly    31 LPGPRPLPFLGNL--LMYRGLDPEQIMDFVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSS 93

  Fly   115 NLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVH 179
            .      ||..:...:.|.:.|        ...||....|.:|...|:|:....   :...::..
  Fly    94 Q------QHITKNNLYKLLNCW--------LGDGLLMSTGRKWHGRRKIITPTF---HFKILEQF 141

  Fly   180 IESCTRR---MVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSV--- 238
            :|...::   ||:|.:.|......|.:          .|:    :...:::::.....||.:   
  Fly   142 VEIFDQQSAVMVEQLQSRADGMTPINI----------FPV----ICLTALDIIAETAMGTKINAQ 192

  Fly   239 --LTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILR-------LPIWRDFEANVDEVLRE 294
              ...|.:|:..| .|.|:.|.|.|:.:.:.:..||.|...       :.:..||..|:....||
  Fly   193 KNPNLPYVQAVND-VTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENIIRERRE 256

  Fly   295 GAAIIDHCIRVQEDQRRPHDE----------ALYHRLQAADVPG----DMIKRIFVDLVIAAG-D 344
              .::::     ..:..|.:|          ||...|..:.:.|    |...|..||..:..| |
  Fly   257 --TLVNN-----SKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHD 314

  Fly   345 TTAFSSQWALFALSKEPRLQQRLAKE---------------RATNDSRLMHGLIKESLRLYPVAP 394
            ||..:..:.|:.:|:.|.:||||.:|               |...:.:.|..:|||||||:|..|
  Fly   315 TTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVP 379

  Fly   395 FIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPF 459
            .|||:..:|.::.|..|...|...:.::...|||.:||.|:...|||: ..:..|:| .:..:||
  Fly   380 MIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERF-DADVPQIH-PYAYIPF 442

  Fly   460 AIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPR 518
            :.|.|:|||::.|:.::.|.:.:....||:..|...|..| :.:|......:.|.|:||
  Fly   443 SAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPRHS-MNIVLRSANGVHLGLKPR 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 113/488 (23%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 116/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.