DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp27a1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_849178.2 Gene:Cyp27a1 / 301517 RGDID:727915 Length:533 Species:Rattus norvegicus

Alignment Length:565 Identity:164/566 (29%)
Similarity:253/566 (45%) Gaps:98/566 (17%)


  Fly    11 LRWLRHLLDQLLVRILSLSL----FRSRCD-PPPLQRFPATELPPAVAAKYVPIPRVKG---LPV 67
            |||.  |||   .|::...|    .|::.. |..|:...:||.|.....:    ||::.   ||.
  Rat     9 LRWA--LLD---TRVMGHGLCPQGARAKAAIPAALRDHESTEGPGTGQDR----PRLRSLAELPG 64

  Fly    68 VGT---LVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQ 129
            .||   |..|...|...|||:.......:|||::.... ||:..|.::||.|:..|.:.||:||.
  Rat    65 PGTLRFLFQLFLRGYVLHLHELQALNKAKYGPMWTTTF-GTRTNVNLASAPLLEQVMRQEGKYPI 128

  Fly   130 HPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLL--------NGNLNWMDVHIESCTRR 186
            ....:.|..:........|:|..:|.:|.|.|..||:.:|        ...||  :|..:...| 
  Rat   129 RDSMEQWKEHRDHKGLSYGIFITQGQQWYHLRHSLNQRMLKPAEAALYTDALN--EVISDFIAR- 190

  Fly   187 MVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTC--PKIQSSLD 249
             :||.:..:|         ||:    ::|.:...||..::|.:|.|:|...| .|  |.|.....
  Rat   191 -LDQVRTESA---------SGD----QVPDVAHLLYHLALEAICYILFEKRV-GCLEPSIPEDTA 240

  Fly   250 YFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRPHD 314
            .|.:.|..:|::|. .:||.|:.::.| ||.|:.:..|.|.:...|..:|..  :|||       
  Rat   241 TFIRSVGLMFKNSV-YVTFLPKWSRPL-LPFWKRYMNNWDNIFSFGEKMIHQ--KVQE------- 294

  Fly   315 EALYHRLQAADVPGDMI---------KRI---------FVDLVIAAGDTTAFSSQWALFALSKEP 361
              :..:||||...|..:         |.:         |.:|::|..|||:.:..|||:.|||.|
  Rat   295 --IEAQLQAAGPDGVQVSGYLHFLLTKELLSPQETVGTFPELILAGVDTTSNTLTWALYHLSKNP 357

  Fly   362 RLQQRLAKE--------RATNDSRLMH-----GLIKESLRLYPVAPFIGRYLPQ-DAQLGGHFIE 412
            .:|:.|.||        :...:....|     .:|||:||||||.|...|.:.: :.::.|....
  Rat   358 EIQEALHKEVTGVVPFGKVPQNKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGFLFP 422

  Fly   413 KDTMVLLSLYTAGRDPSHFEQPERVLPERWC---IGETEQVHKSHGSLPFAIGQRSCIGRRVALK 474
            |:|..:|..|...||||.|.:||...|.||.   ..:...:....||:||..|.|||:|||:|..
  Rat   423 KNTQFVLCHYVVSRDPSVFPEPESFQPHRWLRKREDDNSGIQHPFGSVPFGYGVRSCLGRRIAEL 487

  Fly   475 QLHSLLGRCAAQFEMSCLNEM-PVDSVLRMVTVPDRTLRLALRPR 518
            ::..||.|...::|:.....| .|.||.|:|.||.:.:.|....|
  Rat   488 EMQLLLSRLIQKYEVVLSPGMGEVKSVSRIVLVPSKKVSLRFLQR 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 139/486 (29%)
Cyp27a1NP_849178.2 p450 63..529 CDD:278495 146/498 (29%)
Sterol-binding. {ECO:0000255} 386..400 7/14 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13166432
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127298
Panther 1 1.100 LDO PTHR24291
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.