DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp11a1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_058982.1 Gene:Cyp11a1 / 29680 RGDID:69325 Length:526 Species:Rattus norvegicus

Alignment Length:531 Identity:122/532 (23%)
Similarity:224/532 (42%) Gaps:55/532 (10%)


  Fly    21 LLVRILSL-SLFRSRCDP--PPLQRFPATELPPAVAAKYVPIPR-VKGLPVVG-----TLVDLIA 76
            :|.:.|.| |:....|.|  .|:.:.|...............|| ...:|..|     .|...:.
  Rat     1 MLAKGLCLRSVLVKSCQPFLSPVWQGPGLATGNGAGISSTNSPRSFNEIPSPGDNGWINLYHFLR 65

  Fly    77 AGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQ 141
            ..|...:|.:.....::||||:||:| |..::|::........:|..||..|:..|...|..|:|
  Rat    66 ENGTHRIHYHHMQNFQKYGPIYREKL-GNMESVYILDPKDAATLFSCEGPNPERYLVPPWVAYHQ 129

  Fly   142 QHACQRGLFFMEGAEWLHNRRILNRLLL--NGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLA 204
            .:....|:.|.....|..:|.:||:.::  :...|::.: :|...:..:....||      |...
  Rat   130 YYQRPIGVLFKSSDAWRKDRIVLNQEVMAPDSIKNFVPL-LEGVAQDFIKVLHRR------IKQQ 187

  Fly   205 ESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSV-----LTCPKIQSSLDYFTQIVHKVFEHSSR 264
            .||:....    :...|:|::.|.:..::||..:     :..|:.|..:|    .|:::|..|..
  Rat   188 NSGKFSGD----ISDDLFRFAFESITSVVFGERLGMLEEIVDPESQRFID----AVYQMFHTSVP 244

  Fly   265 LMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRPHD-----EALYHRLQAA 324
            ::..||.|.::.|...|:|..|..|.:..:..   ::......|.|:..|     ..||..|...
  Rat   245 MLNMPPDLFRLFRTKTWKDHAAAWDVIFSKAD---EYTQNFYWDLRQKRDFSKYPGVLYSLLGGN 306

  Fly   325 DVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRL------AKERATNDSR------ 377
            .:|...|:....:::....|||:.:.||.|:.::...::|:.|      |:.:|..|..      
  Rat   307 KLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEVLAARRQAQGDMAKMVQLV 371

  Fly   378 -LMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPER 441
             |:...|||:|||:|::..:.||:..|..|..:.|...|:|.::.|..||:.|.|..|.:..|.|
  Rat   372 PLLKASIKETLRLHPISVTLQRYIVNDLVLRNYKIPAKTLVQVASYAMGRESSFFPNPNKFDPTR 436

  Fly   442 WCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTV 506
            |........|..:  |.|..|.|.|:|||:|..::...|......|.:...:...|.:...::.:
  Rat   437 WLEKSQNTTHFRY--LGFGWGVRQCLGRRIAELEMTIFLINVLENFRIEVQSIRDVGTKFNLILM 499

  Fly   507 PDRTLRLALRP 517
            |::.:....:|
  Rat   500 PEKPIFFNFQP 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 109/464 (23%)
Cyp11a1NP_058982.1 p450 50..508 CDD:278495 111/479 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.