DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-34A9

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001041072.1 Gene:cyp-34A9 / 181851 WormBaseID:WBGene00015044 Length:516 Species:Caenorhabditis elegans

Alignment Length:553 Identity:107/554 (19%)
Similarity:188/554 (34%) Gaps:165/554 (30%)


  Fly    17 LLDQLLVRILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLI----AA 77
            |:...:|.|.:::|:|:|      |:.|....|               ||::|.|..||    ..
 Worm     5 LILSAIVAIFTVNLWRAR------QKLPKGPTP---------------LPLIGNLHQLIYNAWKN 48

  Fly    78 GGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQ-----HPLPDAWT 137
            ||   :.:..:...||||.:|...:|.      :.|.::......||....:     |...:...
 Worm    49 GG---IVQGFNEFKKQYGNVFTIWMGP------IPSVHIADFDVAHETHVKRANTFGHRFSNGGM 104

  Fly   138 LYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIP 202
            .|.::   .||:....|..|..:||.....|.|..|.          |.:::.            
 Worm   105 DYIRE---GRGIIASNGEFWQEHRRFALTTLRNFGLG----------RNIMED------------ 144

  Fly   203 LAESGEIRSYELPLLEQQLYRW-------------SIEVLCC--IMFGT---SVLTCPKIQSSLD 249
                        .::|:..||:             .:....|  ::.|:   .:|...:.:....
 Worm   145 ------------KIMEEYRYRFKDFKNTHFKNGGIQVNASSCFDLLVGSIINQLLVSERFEQDNK 197

  Fly   250 YFTQI---VHKVFEHSSRLMTFPPRLAQILRLPIWR--------DF-----EANVDEVL------ 292
            .|.::   :.|..|..|....|.|......:|..||        ||     |..:.:.:      
 Worm   198 EFERLKTSLAKGLEKVSIFEAFMPVWVLKSKLMRWRTKTTFEPFDFIFGLVERGIQKRVSAIKNG 262

  Fly   293 -----REGAAIID-HCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQ 351
                 .||...:| ..|::::|:    :|.:........:..|:     .||.:|..:||:.:..
 Worm   263 THIPSEEGEDFVDAFLIKMEKDK----NEGIQSTFDLETLAVDL-----YDLWLAGQETTSTTLT 318

  Fly   352 WALFALSKEPRLQQRLAKE--RATNDSRLMHGLIKESLRLYPVAPFIG----------------- 397
            ||...|...|.:.:.:.||  ..|..:|.:      ||...|..|::|                 
 Worm   319 WACACLLNYPEVVKEIRKELTEVTGGTRSL------SLTDRPKTPYLGATINEIQRIASILNVNI 377

  Fly   398 -RYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAI 461
             |.:.:|:.:.|..|....::...|.....|...|:......|||:.  |...:.|.  .:||.|
 Worm   378 FRLMEEDSIIEGQPISAGAVLTTQLAMLHTDEKTFKNHTEFRPERFL--ENNNLEKR--LIPFGI 438

  Fly   462 GQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNE 494
            |:|||:|..:|..:|:.....|.    ...|||
 Worm   439 GKRSCLGESLARAELYLASEMCV----FDTLNE 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 98/508 (19%)
cyp-34A9NP_001041072.1 p450 26..511 CDD:278495 100/527 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.