DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-34A7

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_504101.1 Gene:cyp-34A7 / 181849 WormBaseID:WBGene00015042 Length:499 Species:Caenorhabditis elegans

Alignment Length:542 Identity:110/543 (20%)
Similarity:191/543 (35%) Gaps:145/543 (27%)


  Fly    22 LVRILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGATHLHKY 86
            :..:|:::|:|:|      |:.|....|               ||::|....|...|     .||
 Worm    10 IAAVLTVNLWRAR------QKLPNGPTP---------------LPIIGNFHQLFYNG-----WKY 48

  Fly    87 ------IDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQ-HPLPDAWTLYNQQHA 144
                  .|...||||.:|...:|.. .||.:...::     .||....: |.....:|....::.
 Worm    49 GGLVAGFDQFRKQYGKVFTVWMGPI-PAVQICDFDV-----AHETHVKKAHTFGHRYTFGAMEYI 107

  Fly   145 CQ-RGLFFMEGAEWLHNRRILNRLLLNGNL--NWMDVHIESCTRRMVDQWKRRTAEAAAIPL--- 203
            .: :|:....|..||.:||.....|.|..|  |.::..|....|...:.:|:...:..||.:   
 Worm   108 REGKGIIGSNGDFWLEHRRFALMTLRNFGLGRNIIEDKIMEEYRYRFEDFKKTNFKDGAIQVNAS 172

  Fly   204 -------------------------------------AESGEIRSYELPL--LEQQLYRWSIEVL 229
                                                 .|:|.|....|||  |:.:..:|.    
 Worm   173 SLFDLLVGSIINQLLVSERFEQDDEEFEELKTNLAMALENGSIIEGVLPLWMLKSRFMKWR---- 233

  Fly   230 CCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLRE 294
                  |.....|     .|:..::..|..:.         |:|.|         |.....:..|
 Worm   234 ------TKTTFAP-----FDFVFEVGKKGIQR---------RVAAI---------ENGTHTLSEE 269

  Fly   295 GAAIID-HCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALS 358
            |...:| ..:::::|::...|.:......|.|:         .||..|..:||:.:..||...|.
 Worm   270 GDDFVDAFIVKMEKDKKDGIDSSFTLETLAVDL---------FDLWQAGQETTSTTLTWACACLL 325

  Fly   359 KEPRLQQRLAKE--RATNDSR-----------LMHGLIKESLRLYPVAPF-IGRYLPQDAQLGGH 409
            ..|.:.::|.||  ..|..:|           .::..|.|..|:..:... :.|.|.:||.:.||
 Worm   326 NHPEVVEKLRKELTEVTGGARGVSLTDRTKTPYLNATINEVQRISSILNVNLLRILEEDAVIDGH 390

  Fly   410 FIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALK 474
            .:...|.....|.....|...|:..:..:|||:.  |...:.|.  .:||.||:|||.|..:|..
 Worm   391 PVPAGTAFTTQLALLHTDEETFKNHKEFIPERFL--ENNNLEKR--LIPFGIGKRSCPGESLAKA 451

  Fly   475 QLHSLLGRCAAQFEMSCLNEMP 496
            :|:.::|.....|::..:..:|
 Worm   452 ELYLIIGNLVIDFDLKPVGAIP 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 103/502 (21%)
cyp-34A7NP_504101.1 p450 26..494 CDD:278495 105/521 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.