DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-29A2

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_505847.1 Gene:cyp-29A2 / 179550 WormBaseID:WBGene00011830 Length:503 Species:Caenorhabditis elegans

Alignment Length:535 Identity:112/536 (21%)
Similarity:194/536 (36%) Gaps:160/536 (30%)


  Fly    83 LHKYIDARHKQYG---------PIFRERLG-----GTQD--AVFVSSANLMRGVFQHEGQYPQHP 131
            |.||  .||.|||         ||| ..||     .|:|  :||::.|...|             
 Worm    23 LLKY--KRHWQYGSKLPGPPAHPIF-GNLGPIVGKKTEDLPSVFINWAAEQR------------- 71

  Fly   132 LPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTR-------RMVD 189
                    :|.|:..|.:...:...|..|.:....:            |:|.|.       |..|
 Worm    72 --------DQGHSVMRVMILGKVYAWPLNGKAAAAI------------IDSTTETNKGDDYRFFD 116

  Fly   190 QW---------------KRRTAEAAAIPLAESG---EIRSYELPLLEQQLYRWS-----IEVL-- 229
            .|               ..|.....|...|:.|   |:.:.|..:|...|..:|     :::.  
 Worm   117 PWLGGGLLLEGYGERWKSHRKMLTPAFHFAKLGGYFEVFNNESKILIDLLSDFSASGETVDIFPY 181

  Fly   230 ---CCIMFGTSVLTCPKIQSSLDYFTQIVHKV--FEHSSRLMTFPPRLAQILRLPIW-RDFEANV 288
               |.:...:......||.:.:::..:.|..|  :.....|::|.|.|..  :...| ..::|..
 Worm   182 VKRCALDIISETAMGIKIDAQINHDHKYVQAVEGYNKIGVLVSFNPHLKN--QFIFWATGYKAQY 244

  Fly   289 DEVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRI--FVDLVI----------- 340
            |:.|....::.:   :|.:::|..||        :.:|..:..||:  |:||::           
 Worm   245 DDYLSTLKSMTE---KVIKERRAAHD--------SGEVEKETSKRMMNFLDLMLSMEESNQLTSE 298

  Fly   341 -----------AAGDTTAFSSQWALFALSKEPRLQQRLAKE---------------RATNDSRLM 379
                       |..|||..|:.||.:.|:..|.:|:::.||               ...|:...:
 Worm   299 DIRQEVDTFMFAGHDTTTSSTSWACWNLAHNPNVQEKVYKEMIEVFGDDPNTDITLENVNNLNYL 363

  Fly   380 HGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEK------DTMVLLSLYTAGRDPSHFEQPERVL 438
            ..::|||.|:....|.:.|.|..|.::.|:.:..      ..|||.|.:...::|:.| .|:|.|
 Worm   364 DIVLKESKRIIAPVPALQRKLTNDLEIDGYIVPAGGNVTISPMVLHSNHHVFKNPTEF-NPDRFL 427

  Fly   439 PERWCIGETEQVHKSH--GSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMS-CLNEMPVDSV 500
            |        ::|.|.|  ..:||..|.|:|||::.|......::......|::. .|........
 Worm   428 P--------DEVSKRHPYDFMPFLAGPRNCIGQKFAQLNEKVMISHIVRNFKIEPTLKYNDTKPC 484

  Fly   501 LRMVTVPDRTLRLAL 515
            |.:||.|...:.:.|
 Worm   485 LEVVTKPSNGIPVRL 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 107/516 (21%)
cyp-29A2NP_505847.1 p450 37..495 CDD:278495 103/514 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.