DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-32B1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_503598.1 Gene:cyp-32B1 / 178697 WormBaseID:WBGene00021167 Length:516 Species:Caenorhabditis elegans

Alignment Length:428 Identity:88/429 (21%)
Similarity:171/429 (40%) Gaps:109/429 (25%)


  Fly   148 GLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIR-- 210
            ||....|.:|...|::|.:..          |.     .::.::::.......| |.|..::|  
 Worm   128 GLLISTGDKWRSRRKMLTQTF----------HF-----AVLKEYQKIFGAQGKI-LVEVLQLRAN 176

  Fly   211 ---SYE-LPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPR 271
               |:: :|.::    |.:::::|....|.|:   ...:.:.|.:...|.::    |.::....:
 Worm   177 NKFSFDIMPYIK----RCALDIICETAMGCSI---SSQRGANDEYVNSVRRL----SEIVWNYEK 230

  Fly   272 LAQILRLPIW--------------------RDFEANVDEVLR---------EGAAIIDHCIRVQE 307
            ..|....|||                    ||...|..:.|:         :..|.:|:.::.||
 Worm   231 APQFWLKPIWYLFGDGFEFNRHVKLTTDFTRDVIENRKKELKTHNSEQNETKKLAFLDYLLKSQE 295

  Fly   308 DQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAG-DTTAFSSQWALFALSKEPRLQQRLAK-- 369
            :.              .|:..|...|..||..:..| |||:....:|::.|.:.|..|||:..  
 Worm   296 EH--------------PDILTDEGIREEVDTFMFEGHDTTSSGITFAVWFLGQFPEYQQRVHDEL 346

  Fly   370 --------ERATNDSRL-----MHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMV---- 417
                    ||..|...:     :...|||:||:.|..||:.|.|.:|.:: .|..:.|.::    
 Worm   347 DEIFGEDFERIPNSEDIQKMVYLEQCIKETLRMTPPVPFVSRKLTEDVKI-PHATKPDLLLPAGI 410

  Fly   418 --LLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLL 480
              ::::.|..:|..:||:|....||.:. .|.....:....:||:.|.|:|||::.||.:...||
 Worm   411 NCMINIITIMKDARYFERPYEFFPEHFS-PERVAAREPFAFVPFSAGPRNCIGQKFALLEEKVLL 474

  Fly   481 GRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPR 518
            ......|.::.:.:.|.:     :.:|:    |.|:|:
 Worm   475 SWIFRNFTVTSMTKFPEE-----MPIPE----LILKPQ 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 84/406 (21%)
cyp-32B1NP_503598.1 p450 42..510 CDD:278495 88/429 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.