DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-37A1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_496939.2 Gene:cyp-37A1 / 175053 WormBaseID:WBGene00008499 Length:508 Species:Caenorhabditis elegans

Alignment Length:421 Identity:84/422 (20%)
Similarity:163/422 (39%) Gaps:119/422 (28%)


  Fly   148 GLFFMEGAEWLHNRRILN-----------RLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAI 201
            ||....|.:|...|:::.           :::.|.....:...||:..::..|.    |.:|   
 Worm   124 GLLLASGEKWRGRRKMMTPSFHFNVLIDFQVVFNSQSMILLEQIENAAKKTDDS----TIDA--- 181

  Fly   202 PLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLM 266
                        .|.::    |.:::::|....||:|      .:..::....|..|.|.:|...
 Worm   182 ------------FPYIK----RCALDIICETAMGTTV------SAQTNHTHPYVVAVNEMNSLAF 224

  Fly   267 TFPPRLAQILRLP-IW-----------RDFEANVDEVLREGAAIIDHCIRVQEDQRRPHDEALYH 319
            .:.       |:| :|           .||:.|:|.|......:||.       :.|.|||    
 Worm   225 KYQ-------RMPWLWIKPIRQLIGYEADFQRNLDIVTSFTKKVIDR-------KLREHDE---- 271

  Fly   320 RLQAAD----VPGDMIKRIFVDLVI----------------------AAGDTTAFSSQWALFALS 358
                .|    |..:..|:.|:|::|                      ...|||:....|:|:.|:
 Worm   272 ----TDGMVVVEEESKKKAFLDMLIEKKEEGGLGYEDIREEVDTFMFEGHDTTSAGIGWSLWCLA 332

  Fly   359 KEPRLQQR-----------LAKERATNDSRLMHGL---IKESLRLYPVAPFIGRYLPQDAQLGGH 409
            ..|..|::           .::|.:..|.:.|..|   :||:||:.|..|.:.|.:.::.::.|.
 Worm   333 NCPEYQKKCHEELDEIFEGTSRECSVEDLKKMKYLEKCVKEALRMRPSVPQMARSVEEEVEIDGK 397

  Fly   410 FIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALK 474
            .:.|...|::|......:|..|...|...|||:...|..:.| ::..:||:.|.|:|||::.|::
 Worm   398 ILPKGCSVMISPAFIQNNPRTFPNHEVFDPERFNEDEISKRH-AYAYIPFSAGPRNCIGQKFAMQ 461

  Fly   475 QLHSLLGRCAAQF----EMSCLNEMPVDSVL 501
            :..:::.....:|    ::..|..||:...:
 Worm   462 EEKTVISWVLRRFHIHTDIGLLENMPLPETI 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 84/416 (20%)
cyp-37A1NP_496939.2 p450 41..503 CDD:278495 84/422 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.