DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-44A1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_495052.1 Gene:cyp-44A1 / 173936 WormBaseID:WBGene00000375 Length:489 Species:Caenorhabditis elegans

Alignment Length:520 Identity:106/521 (20%)
Similarity:209/521 (40%) Gaps:68/521 (13%)


  Fly    12 RWLRHLLDQLLVRILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTL---VD 73
            |.:|:|.:.:           .:|...|      |..|......:..||..:.:||:|.:   ..
 Worm     3 RSIRNLAENV-----------EKCPYSP------TSSPNTPPRTFSEIPGPREIPVIGNIGYFKY 50

  Fly    74 LIAAGGAT--HLHKYIDARHKQYGPIFRERLG-GTQDAVFVSSANLMRGVFQHEGQYP-QHPLPD 134
            .:.:...|  :.:::::..:|:||.|.:|.|| |.:..|.:.....::.|...:|:.| ..||.:
 Worm    51 AVKSDAKTIENYNQHLEEMYKKYGKIVKENLGFGRKYVVHIFDPADVQTVLAADGKTPFIVPLQE 115

  Fly   135 AWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGN-----LNWMDVHIESCTRRMVDQWKRR 194
            ....|.:......||..:.|.||...|..:...::...     |.:..:........:.||.|| 
 Worm   116 TTQKYREMKGMNPGLGNLNGPEWYRLRSSVQHAMMRPQSVQTYLPFSQIVSNDLVCHVADQQKR- 179

  Fly   195 TAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVF 259
                             :.|..:::...|||:|....|:|..|:.:........|...::..|:|
 Worm   180 -----------------FGLVDMQKVAGRWSLESAGQILFEKSLGSLGNRSEWADGLIELNKKIF 227

  Fly   260 EHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHC---IRVQEDQRRPHDEALY--- 318
            :.|:::....| :.::...|.||......|:...|...::|..   ::|.:...:....|.|   
 Worm   228 QLSAKMRLGLP-IFRLFSTPSWRKMVDLEDQFYSEVDRLMDDALDKLKVNDSDSKDMRFASYLIN 291

  Fly   319 -HRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEP----RLQQRLAKERATNDSRL 378
             ..|...||     |.|.:.:......|||....:.|:.|:..|    .:|:.:.::.|::....
 Worm   292 RKELNRRDV-----KVILLSMFSDGLSTTAPMLIYNLYNLATHPEALKEIQKEIKEDPASSKLTF 351

  Fly   379 MHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHF-EQPERVLPERW 442
            :...|||:.|::|:...:.|...::..|.|:.:...|.|.::.....|....| :.|....|:||
 Worm   352 LRACIKETFRMFPIGTEVSRVTQKNLILSGYEVPAGTAVDINTNVLMRHEVLFSDSPREFKPQRW 416

  Fly   443 CIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVP 507
             :.::::|| ....|||..|.|.|.|||.|.:.|.:.|.:....:::....: |:..:...:.:|
 Worm   417 -LEKSKEVH-PFAYLPFGFGPRMCAGRRFAEQDLLTSLAKLCGNYDIRHRGD-PITQIYETLLLP 478

  Fly   508  507
             Worm   479  478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 96/458 (21%)
cyp-44A1NP_495052.1 p450 34..477 CDD:299894 97/470 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127298
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.