DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP24A1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_000773.2 Gene:CYP24A1 / 1591 HGNCID:2602 Length:514 Species:Homo sapiens

Alignment Length:534 Identity:150/535 (28%)
Similarity:240/535 (45%) Gaps:71/535 (13%)


  Fly    27 SLSLF----RSRCDPPPLQRFPA------TELP--PAVAA----KYVPIPRVKGLPVVGTLVDLI 75
            ||:.|    ||...||.|....|      .|:|  |..|.    ....:|.....|::|:|:.::
Human    10 SLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQIL 74

  Fly    76 AAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYN 140
            ..||....|..:...||:||.|||.:| |:.::|.:.|..|:..:::.|..|||......|..|.
Human    75 WKGGLKKQHDTLVEYHKKYGKIFRMKL-GSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYR 138

  Fly   141 QQHACQRGLFFMEGAEWLHNRRILNRLLLN-GNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLA 204
            .......||..:||.:|...|....:.|:. |.:..:|..|    ..::..:..|..|..    .
Human   139 DYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKI----NEVLADFMGRIDELC----D 195

  Fly   205 ESGEIRSYELPLLEQQLYRWSIEVLCCIM----FGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRL 265
            |.|.:..     |..:|.:||.|.:|.::    ||   |...........|...:..:.....|:
Human   196 ERGHVED-----LYSELNKWSFESICLVLYEKRFG---LLQKNAGDEAVNFIMAIKTMMSTFGRM 252

  Fly   266 MTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRPHDEAL---YHRLQAADVP 327
            |..|..|.:.|...:|:|.....|.:.:...|.||:  |:::..::|..:.|   ||:.:.:.  
Human   253 MVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDN--RLEKYSQQPSADFLCDIYHQNRLSK-- 313

  Fly   328 GDMIKRIF---VDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE-----------RATNDSRL 378
                |.::   .:|.:||.:|||.|..|.|:.||:.|::||:|.||           || .|.|.
Human   314 ----KELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRA-EDLRN 373

  Fly   379 MHGL---IKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPE 440
            |..|   :|||:||.|..||..|.|.:...||.:.:.|.|:::|:....|....:||...:..||
Human   374 MPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQVLGSSEDNFEDSSQFRPE 438

  Fly   441 RWCIGETEQVHK-SHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMV 504
            || :.|.|:::. :|  |||.:|:|.|||||:|..|||..|.....::::...:..||:.:....
Human   439 RW-LQEKEKINPFAH--LPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGT 500

  Fly   505 TVPDRTLRLALRPR 518
            .||.|.|.:|...|
Human   501 LVPSRELPIAFCQR 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 129/460 (28%)
CYP24A1NP_000773.2 p450 59..512 CDD:278495 136/482 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13168049
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127298
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.