DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP11B2

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_000489.3 Gene:CYP11B2 / 1585 HGNCID:2592 Length:503 Species:Homo sapiens

Alignment Length:521 Identity:143/522 (27%)
Similarity:229/522 (44%) Gaps:72/522 (14%)


  Fly    28 LSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHK 92
            |||.|:|.......|.|.|.||      :..:|:..|...: .|:.:....|..|||..:....:
Human    16 LSLQRARALGTRAARAPRTVLP------FEAMPQHPGNRWL-RLLQIWREQGYEHLHLEMHQTFQ 73

  Fly    93 QYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEW 157
            :.|||||..|||.: .|.|.....:..:.|.:..:|...:.:.|..|.|....:.|:|.:.|.||
Human    74 ELGPIFRYNLGGPR-MVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEW 137

  Fly   158 LHNRRILNRLLLNGNLNWMDVHIESCTRR---MVDQWKRRTAEAAAIPLAESGEIRSYELPL-LE 218
            ..||..||          .||......:|   |||...|..::|....:.::..   ..|.| ::
Human   138 RFNRLRLN----------PDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNAR---GSLTLDVQ 189

  Fly   219 QQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDY-FTQIVHKVFEHSSRLMTFPPRLAQILRLPIWR 282
            ..::.::||.....:||..:.......||... |...:..:|:.:.:||..|..|::.:...:|:
Human   190 PSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWK 254

  Fly   283 D-FEANVDEVLREGAAIIDHCIRVQEDQRRPHDEALYHR-----------LQAADVPGDMIKRIF 335
            : ||| .|.:.:.|    |:||      ::.:.|..::|           |..|::..:.||...
Human   255 EHFEA-WDCIFQYG----DNCI------QKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANS 308

  Fly   336 VDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE-------------RATNDSRLMHGLIKESL 387
            ::|...:.|||||.....||.|::.|.:||.|.:|             :||.:..|:...:||:|
Human   309 MELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETL 373

  Fly   388 RLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERW--CIGETEQV 450
            |||||..|:.|.:..|..|..:.|...|:|.:.||:.||:.:.|.:|||..|:||  ..|.....
Human   374 RLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNF 438

  Fly   451 HKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNE----MPVDSVLRMVTVPDRTL 511
            |    .:||..|.|.|:|||:|..::..||......|.:..|.:    |....:||..|.|..|.
Human   439 H----HVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTF 499

  Fly   512 R 512
            |
Human   500 R 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 126/470 (27%)
CYP11B2NP_000489.3 p450 42..454 CDD:278495 120/442 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.