DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP11A1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_000772.2 Gene:CYP11A1 / 1583 HGNCID:2590 Length:521 Species:Homo sapiens

Alignment Length:459 Identity:111/460 (24%)
Similarity:209/460 (45%) Gaps:43/460 (9%)


  Fly    82 HLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQ 146
            |||..  ...::||||:||:||.. ::|:|.....:..:|:.||..|:..|...|..|:|.:...
Human    75 HLHHV--QNFQKYGPIYREKLGNV-ESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRP 136

  Fly   147 RGLFFMEGAEWLHNRRILNRLLL--NGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEI 209
            .|:...:.|.|..:|..||:.::  ....|::.: :::.:|..|....||..:|.:...  ||:|
Human   137 IGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPL-LDAVSRDFVSVLHRRIKKAGSGNY--SGDI 198

  Fly   210 RSYELPLLEQQLYRWSIEVLCCIMFG-----TSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFP 269
                    ...|:|::.|.:..::||     ...:..|:.|..:|    .::::|..|..::..|
Human   199 --------SDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFID----AIYQMFHTSVPMLNLP 251

  Fly   270 PRLAQILRLPIWRDFEANVDEVLREGAAIIDHC---IRVQEDQRRPHDEALYHRLQAADVPGDMI 331
            |.|.::.|...|:|..|..|.:..:......:.   :|.:......:...||..|..:.:..:.|
Human   252 PDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDI 316

  Fly   332 KRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRL------AKERATNDSR-------LMHGLI 383
            |....:::....|||:.:.||.|:.:::..::|..|      |:.:|..|..       |:...|
Human   317 KANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASI 381

  Fly   384 KESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETE 448
            ||:|||:|::..:.|||..|..|..:.|...|:|.:::|..||:|:.|..||...|.||...:..
Human   382 KETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKN 446

  Fly   449 QVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRL 513
            ..:  ..:|.|..|.|.|:|||:|..::...|......|.:...:...|.:...::.:|::.:..
Human   447 ITY--FRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISF 509

  Fly   514 ALRP 517
            ...|
Human   510 TFWP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 108/438 (25%)
CYP11A1NP_000772.2 p450 52..511 CDD:278495 110/456 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.