DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-31A5

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans

Alignment Length:315 Identity:58/316 (18%)
Similarity:105/316 (33%) Gaps:117/316 (37%)


  Fly   108 AVFVSSANL----------MRGVFQHEGQYPQHPL--------PDAWTLYNQQHACQRGLFFMEG 154
            ||.::||.:          ||.|.:|..|...:|:        ||.....||  ....|..:.:.
 Worm     7 AVLLASATVIAWLIYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFMNQ--VIGMGYLYPDP 69

  Fly   155 AE---WL------------------HNRRILNR----LLLNGNLNWMDVHIESCTRRMVDQWKRR 194
            ..   |:                  .:.:.||:    :||.   .|:.:.|.:..:   :||  |
 Worm    70 RMCLLWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLE---PWLGISILTSQK---EQW--R 126

  Fly   195 TAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFG------TSVLTCPKI----QSSL- 248
            .......|......::.: ||:..:| .:..|:.|||:...      .||:|...:    ::|: 
 Worm   127 PKRKLLTPTFHYDILKDF-LPIFNEQ-SKILIQKLCCLGVADEEVDVLSVITLCTLDIICETSMG 189

  Fly   249 ----------DYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCI 303
                      :.:...||.:.:..|:....|         .:|..|..|:.|   :|        
 Worm   190 KAIGAQLAENNEYVWAVHTINKLISKRTNNP---------LMWNSFIYNLTE---DG-------- 234

  Fly   304 RVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDT-------TAFSSQ 351
                   |.|::.|:       :..|..|::.|:...|..|:       .|||.|
 Worm   235 -------RTHEKCLH-------ILHDFTKKVIVERKEALQDSDYKMEGRLAFSRQ 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 58/316 (18%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 44/271 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.