DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp19a1

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001335100.1 Gene:Cyp19a1 / 13075 MGIID:88587 Length:503 Species:Mus musculus

Alignment Length:562 Identity:111/563 (20%)
Similarity:208/563 (37%) Gaps:156/563 (28%)


  Fly    39 PLQRFPATELPPAVAAKYVPIPRVKGLPV-------------------VGTLVD-----LIAAGG 79
            |:|......:|..|....:|:..:.||.:                   :|.|:.     .:..|.
Mouse     8 PMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESSSSIPGPGYCLGIGPLISHGRFLWMGIGS 72

  Fly    80 ATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHA 144
            |.:.:      :|.||...|..:.| ::.:.:|.::.|..|.:|     .|        |..:..
Mouse    73 ACNYY------NKMYGEFMRVWISG-EETLIISKSSSMFHVMKH-----SH--------YISRFG 117

  Fly   145 CQRGLFFMEGAEWLHNRRILNRLLLNGNLN-WMDVH---------------IESCTRRMVDQWKR 193
            .:|||..:    .:|.    |.::.|.|.: |..:.               :|.|...:.....|
Mouse   118 SKRGLQCI----GMHE----NGIIFNNNPSLWRTIRPFFMKALTGPGLVRMVEVCVESIKQHLDR 174

  Fly   194 RTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCC---IMFGTS---VLTCPKIQSSLDYFT 252
                     |.|..:...|             ::||..   ||..||   .|..|..:|:     
Mouse   175 ---------LGEVTDTSGY-------------VDVLTLMRHIMLDTSNMLFLGIPLDESA----- 212

  Fly   253 QIVHKV---FEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIID---HCIRVQEDQRR 311
             ||.|:   |.....|:..|....:|..|  :|.:|.:|.::..|.|.:::   |.:...|....
Mouse   213 -IVKKIQGYFNAWQALLIKPNIFFKISWL--YRKYERSVKDLKDEIAVLVEKKRHKVSTAEKLED 274

  Fly   312 PHDEA--LYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKERAT- 373
            ..|.|  |....:..|:..:.:.:..::::|||.||.:.:..:.|..:::.|.::..:.||..| 
Mouse   275 CMDFATDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYFMLLLVAEYPEVEAAILKEIHTV 339

  Fly   374 -----------NDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGR- 426
                       .:.:::...|.||:|..||...:.|...:|..:.|:.::|.|.::|::   || 
Mouse   340 VGDRDIKIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNI---GRM 401

  Fly   427 -------DPSHF--EQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGR 482
                   .|:.|  |..|:.:|.|:             ..||..|.|.|.|:.:|:..:..:|..
Mouse   402 HRLEYFPKPNEFTLENFEKNVPYRY-------------FQPFGFGPRGCAGKYIAMVMMKVVLVT 453

  Fly   483 CAAQFEMS-----CLNEMPVDSVLRMVTVPDRTL-RLALRPR 518
            ...:|::.     |:..:|..:.|.:....||.| .:...||
Mouse   454 LLRRFQVKTLQKRCIENIPKKNDLSLHPNEDRHLVEIIFSPR 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 100/515 (19%)
Cyp19a1NP_001335100.1 p450 48..488 CDD:306555 102/514 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.