DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and LOC100910462

DIOPT Version :8

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_003750411.2 Gene:LOC100910462 / 100910462 RGDID:6498232 Length:500 Species:Rattus norvegicus

Alignment Length:507 Identity:129/508 (25%)
Similarity:228/508 (45%) Gaps:46/508 (9%)


  Fly    30 LFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQY 94
            |.|:|.......:.|.|..|.....:|   .|.|.|    .::.::...|..:||..:....::.
  Rat    19 LHRTRALGSTATQAPKTLKPFEAIPQY---SRNKWL----KMIQILREQGQENLHLEMHQAFQEL 76

  Fly    95 GPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLH 159
            |||||...||.| .|.|........:.|.|...|:....::|..:.:....:||:|.:.||:|..
  Rat    77 GPIFRHSAGGAQ-IVSVMLPEDAEKLHQVESILPRRMTLESWVAHRELRGLRRGVFLLNGADWRF 140

  Fly   160 NRRILNRLLLNGN-----LNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQ 219
            ||..||..:|:..     :.::||    ..|..|:..|:|..|  .:..:.|.:|:|        
  Rat   141 NRLQLNPNMLSPKAVQSFVPFVDV----VARDFVENLKKRMLE--NVHGSMSMDIQS-------- 191

  Fly   220 QLYRWSIEVLCCIMFGTSV-LTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRD 283
            .::.:::|....::.|..: ||...::.....|...:|.:|:.:::||..|..|.:.....:|:.
  Rat   192 NVFNYTMEASHFVISGERLGLTGHDLKPESLKFIHALHSMFKSTTQLMFLPKNLTRWTSTQVWKG 256

  Fly   284 FEANVDEVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAF 348
            ...:.|.:.......|.:..|...:.|:.....:...:..:.:..|.|....::|:..:.||||.
  Rat   257 HFESWDIISEYVTKCIKNVYRELAEGRQQSWSVISEMVAQSTLSMDAIHANSMELIAGSVDTTAI 321

  Fly   349 SSQWALFALSKEPRLQQRLAKE-------------RATNDSRLMHGLIKESLRLYPVAPFIGRYL 400
            |....||.|::.|.:||.|.:|             :|.:|..|:...:||:|||||:...:.|.:
  Rat   322 SLVMTLFELARNPDVQQALRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPIGSSLERIV 386

  Fly   401 PQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRS 465
            ..|..|..:.:...|:|::.||:.||:|:.|.:|||.:|:||.     :..:|...|.|..|.|.
  Rat   387 DSDLVLQNYHVPAGTLVIIYLYSMGRNPAVFPRPERYMPQRWL-----ERKRSFQHLAFGFGVRQ 446

  Fly   466 CIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRP 517
            |:|||:|..::..||......|::..|.:..|....|.|.:|:..|.|.:||
  Rat   447 CLGRRLAEVEVLLLLHHMLKIFQVETLRQEDVQMAYRFVLMPNPRLVLTIRP 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 113/453 (25%)
LOC100910462XP_003750411.2 p450 43..496 CDD:278495 121/480 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.