DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rib and BtbVII

Sequence 1:NP_001261085.1 Gene:rib FlyBaseID:FBgn0003254 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:658 Identity:153/659 (23%)
Similarity:237/659 (36%) Gaps:172/659 (26%)


  Fly    16 QTYCLRWNNHQTNLVQILHALHEVGSYVDCSLVVDDEQFQAHRVVLAANSPYFQHILKDVPQDHC 80
            |.:||||||||.|.:.:..:|...|:.||.:|..:..|.|||::||:|.|.|||.:....|..|.
  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHP 68

  Fly    81 SIILPGVKGFEIAALLQYMYTGETTVTKSQEPEILRTAKELQVKGLYD------NLMKFNHASVT 139
            .:||..|:..::..::.:||.||..|::.|.|.||:||:.|::|||.:      ||.|.:..|.|
  Fly    69 IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDSKSST 133

  Fly   140 PTSS--SGAG---GAKPQNGSASNHSSSVISTSTHISPSAAISSSCSPPPPPQFGYQPGYSHYPQ 199
            ..:.  .|||   ||....||....|.|.:..|...|..|............|...|..:.|..|
  Fly   134 DGTEMVGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQQHHHHQQQ 198

  Fly   200 QQPMSASQ----------------------------------------IPAGEAPLTPTQATPHS 224
            ||.....|                                        :.||.:|.|..:....|
  Fly   199 QQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAGTSPATRRKRLRKS 263

  Fly   225 --------------------AASGAGEAGGQWPLTPSAAAAMLNSVYESAA------DMNPLKRK 263
                                |.||||.||        .:.|.:|.:...|.      .::..|..
  Fly   264 SNNGSGDRNNAEEQHNSSLDAGSGAGNAG--------LSLAQMNQMTFGAGGGLAGHSLHAAKLL 320

  Fly   264 KLSAISSM--------LLSG-----------------NRDTPILRNVLAQANPADSSQPGPMNAN 303
            |.||.:.:        |..|                 |:..|:  ::.....|::...|...:::
  Fly   321 KESASAELEQQPQDSDLDDGHGHLHMQIKPEVDIGGVNQTMPL--DISGGTTPSEHDAPNSQSSH 383

  Fly   304 GEKTPTH-PH-QNTQLPAGLGVSGG----ERNHSFNG---SDYGGDKEPLSPYTDRSFEEETGQS 359
            .|.:|.| || .:..|.|....|||    ||:.|..|   .:...|..|.||....:        
  Fly   384 SEPSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSVECDPDGTPSSPAVMGT-------- 440

  Fly   360 GGKKPEWKRYKQYTRADMMCAIQAVREGMSALQASRKYGLPSRTLYDKVRKLNITTGRGTHRTPK 424
                   ||.:..||.      ..|:....::.::              .:::..|...|.....
  Fly   441 -------KRNRVLTRQ------PRVKRDSDSISST--------------NQISPDTAATTLDFDP 478

  Fly   425 RSPPGAESSQGFSYSAAAAAAAHNYGHGHGHHSEVKRDQKVDHVPAHHGMP-PTIPPSAAALLDH 488
            .:..||.|:....||...:...|:....|.||..:....:::.   |...| |::.||...||..
  Fly   479 FNAAGATSATARDYSTTGSHHLHHQSAVHHHHHLLTVPPRIER---HASEPAPSLAPSTPHLLSV 540

  Fly   489 AFLQQALENRGGD--MAGREALHAMALAAAAHAAANRLSSSPAEMDQRSNGHGMR-------SPS 544
            ......|..:..|  :..:.||| ||.:.:..::|....|:|.....|...|.:.       :|:
  Fly   541 PSSTPYLIKQHSDPLLPRQSALH-MAGSGSGSSSAMATGSNPFAPLHRQYSHPLSGSNASYVTPA 604

  Fly   545 PQGRHYPH 552
            |  .|:||
  Fly   605 P--LHHPH 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ribNP_001261085.1 BTB 33..133 CDD:279045 39/106 (37%)
BTB 44..133 CDD:197585 36/95 (38%)
HTH_psq 373..417 CDD:283007 4/44 (9%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 36/93 (39%)
BTB 32..117 CDD:197585 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.