DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and matn3a

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001004007.1 Gene:matn3a / 445503 ZFINID:ZDB-GENE-040822-21 Length:337 Species:Danio rerio


Alignment Length:115 Identity:28/115 - (24%)
Similarity:41/115 - (35%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SGIVPLGSTLTLV-VAINDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAP 254
            ||..|....::.| :.:.|.|.:..:...|..|......:..:.     |.|..|.|..|.|..|
Zfish   159 SGARPKSKNISKVAIIVTDGRPQDQVEEVSAAARASGIEIYAVG-----VDRADMRSLKLMASNP 218

  Fly   255 --DERATVITYAFFHAF--KFPDALSVHIKCKVEICR--HGCLDHCQNTG 298
              |....|.||......  ||.:.|     |.::.|.  |.|...|.::|
Zfish   219 LEDHVFYVETYGVIEKLTSKFRETL-----CGMDACAMGHDCEHICVSSG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 23/99 (23%)
Zona_pellucida <194..287 CDD:278526 21/97 (22%)
matn3aNP_001004007.1 vWFA 61..282 CDD:294047 28/115 (24%)
Matrilin_ccoil 292..334 CDD:287378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.