DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and matn3a

DIOPT Version :10

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001004007.1 Gene:matn3a / 445503 ZFINID:ZDB-GENE-040822-21 Length:337 Species:Danio rerio


Alignment Length:115 Identity:28/115 - (24%)
Similarity:41/115 - (35%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SGIVPLGSTLTLV-VAINDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAP 254
            ||..|....::.| :.:.|.|.:..:...|..|......:..:.     |.|..|.|..|.|..|
Zfish   159 SGARPKSKNISKVAIIVTDGRPQDQVEEVSAAARASGIEIYAVG-----VDRADMRSLKLMASNP 218

  Fly   255 --DERATVITYAFFHAF--KFPDALSVHIKCKVEICR--HGCLDHCQNTG 298
              |....|.||......  ||.:.|     |.::.|.  |.|...|.::|
Zfish   219 LEDHVFYVETYGVIEKLTSKFRETL-----CGMDACAMGHDCEHICVSSG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 23/99 (23%)
matn3aNP_001004007.1 vWFA 61..282 CDD:469594 28/115 (24%)
Matrilin_ccoil 292..334 CDD:463070
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.