DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and AgaP_AGAP003012

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_311867.4 Gene:AgaP_AGAP003012 / 1272942 VectorBaseID:AGAP003012 Length:695 Species:Anopheles gambiae


Alignment Length:367 Identity:77/367 - (20%)
Similarity:137/367 - (37%) Gaps:84/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISYSRCGTKPDLNGQ 115
            :.|.|....:.|.:..:.||.|.:.:.|:........:...|      ||:..:..|  .|.|.|
Mosquito   357 VSVHCKDTRIAVQVRTNKPFNGRIYALGRSETCNIDVINSDT------FRLDLTMGG--QDCNTQ 413

  Fly   116 ----FYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRGDNVDCW 176
                .|.||||:|:...::...|:..:::|. ::...|..|...:.|.|.::|.::         
Mosquito   414 SATGIYSNTVVLQHHSVVMTKADKIYKVKCT-YDMSSKNISFGMLPIRDPEMIHIN--------- 468

  Fly   177 MEIQHGKGPWAPPVS-----------GIVPLGSTLTLVVAINDYRGEFDMRVKSCVA-SDGSGHV 229
                  ..|.|||..           ..|.:|..||..:.|.: ...:.:..:|||| :..|...
Mosquito   469 ------SSPEAPPPRIRILDARAREVETVRIGDRLTFRIEIPE-DTPYGIFARSCVAMAKDSKST 526

  Fly   230 INLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVHIKCKVEICRHGCLDHC 294
            ..:.|:.||.:.|.:...|.:    |..|   ..:.:.||:|.::..|..:|.|:.|...|    
Mosquito   527 FQIIDDDGCPVDPTIFPAFTQ----DGNA---LQSIYEAFRFTESYGVIFQCNVKYCLGPC---- 580

  Fly   295 QNTGVGGGGGGSGESLGLGLGLGLTNANERKDVHMSDALGSSSNDLLRDLALPPGGQHGMGMGMG 359
             ...|...|..|.||.|          .:|:.|       ::|||.:.:.......|..:.:..|
Mosquito   581 -EPAVCEWGRDSVESWG----------RKRRSV-------TASNDTVEEEEDMNISQEILVLDFG 627

  Fly   360 PDHDIFYEDIIHDHKQTLGGGGMPAGGDYGHEKSVN-LQPRP 400
            .:.:   .|.:.....|          |:|.:|:|. ::|.|
Mosquito   628 DEKN---RDFLRSEAST----------DFGRDKTVTIIEPCP 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 53/246 (22%)
Zona_pellucida <194..287 CDD:278526 23/93 (25%)
AgaP_AGAP003012XP_311867.4 PAN_4 35..86 CDD:290993
PAN_AP_HGF 119..199 CDD:238532
PAN_1 224..315 CDD:278453
ZP 360..576 CDD:214579 53/247 (21%)
Zona_pellucida <490..583 CDD:278526 25/105 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X161
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.