DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atf1 and kay

Sequence 1:NP_001005828.1 Gene:atf1 XenbaseID:XB-GENE-971677 Length:281 Species:Xenopus tropicalis
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:289 Identity:60/290 (21%)
Similarity:114/290 (39%) Gaps:87/290 (30%)


 Frog    18 IQVQGVIQTAQSSTVIHSPQVSAAQASSLSES-----EDSQD----SCDSIETPH--------KG 65
            :|..|..:|.||...:.:|.::.....::.::     .|:|.    .|.....|.        .|
  Fly   232 LQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLG 296

 Frog    66 HGI---LSRRPSYRKIFNDLS------SEDA----GDRKRNEDSPGVSAVIPMSSGTTIYQTSSG 117
            .||   :|..|..:..  |||      |||:    .|.:.||:..        ::.|:...|.|.
  Fly   297 MGIPTGVSSLPLQQTF--DLSLGQGSESEDSNASYNDTQMNEEQD--------TTDTSSAHTDST 351

 Frog   118 QYVTIAPNGTLQFATTSGDGVHS----LQALSMANAGNAQSGTAILQYAQTSDGQQILVPSNQVV 178
            .|..    |.:...:.:|.||::    |.|:| ::.|:|..|::   .|.||:     .|:.:  
  Fly   352 SYQA----GHIMAGSVNGGGVNNFSNVLAAVS-SSRGSASVGSS---NANTSN-----TPARR-- 401

 Frog   179 VQTASGDMQAYQIRTTSTTTSLPQTVVMTSPVALSSPATKTDDPQLKREIRLLKNREAARECRRK 243
               ..|       |..:.:|::                  |.:.:.||.:|..:|::||..||::
  Fly   402 ---GGG-------RRPNRSTNM------------------TPEEEQKRAVRRERNKQAAARCRKR 438

 Frog   244 KKEYVKCLENRVAVLENQNKTLIEELKTL 272
            :.:....|...|..||.:.:::.:|::.|
  Fly   439 RVDQTNELTEEVEQLEKRGESMRKEIEVL 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atf1NP_001005828.1 pKID 54..94 CDD:308015 15/65 (23%)
bZIP_CREB1 225..279 CDD:269838 14/49 (29%)
coiled coil 226..278 CDD:269838 13/48 (27%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 14/49 (29%)
coiled coil 421..480 CDD:269869 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.